SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010061017.1.83385 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010061017.1.83385
Domain Number 1 Region: 45-256
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.13e-22
Family BAR domain 0.076
Further Details:      
 
Domain Number 2 Region: 304-360
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000407
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010061017.1.83385
Sequence length 369
Comment PREDICTED: SH3 domain-containing protein 2 [Eucalyptus grandis]; AA=GCF_000612305.1; RF=representative genome; TAX=71139; STAX=71139; NAME=Eucalyptus grandis; cultivar=BRASUZ1; AL=Scaffold; RT=Major
Sequence
MEAIRKQATKLRDQVAKQQQAVFRQFTGVYGSDNVIADETELQHHQRLEKLYISTRAGKH
FQRDIVRGVEGYIVHGSKQVEIGTKLSEDCRKYGAENTCTTGTTLSKAALNFSRARAQIE
RERGNLLKTLGTQVAEPLRAMVMGAPLEDARQLAQRYDRVRQEAEAQGIDVSRRQARVRD
SMGNPDIVMKLEAAEAKLLELKTNTATLGKEATAAMAAVEGQQQKMTLQRLVAMVESERT
YHQRVLQILDQLEGELLSERQRIEASPSVSVDTSVPPPPPYEEINGSFASQTYDETADTI
DYFLGEVVHPFRGVSDVELSLSAGDYVVVRKVSNSGWAEGECKGKAGWFPLDYVERRERV
LASKMAHVF
Download sequence
Identical sequences A0A059BPX9
XP_010061017.1.83385 Eucgr.F01618.1|PACid:23582335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]