SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010068328.1.83385 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010068328.1.83385
Domain Number 1 Region: 69-238
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.06e-62
Family Inorganic pyrophosphatase 0.00000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010068328.1.83385
Sequence length 251
Comment PREDICTED: soluble inorganic pyrophosphatase 6, chloroplastic [Eucalyptus grandis]; AA=GCF_000612305.1; RF=representative genome; TAX=71139; STAX=71139; NAME=Eucalyptus grandis; cultivar=BRASUZ1; AL=Scaffold; RT=Major
Sequence
MATVRVIPAAAAATTSCLLSRTPRSLKRGALGGGGAGLRLFRRPAAAAPLPSSSRRSFAC
SAIYRPQVKVKEEGKPETLDYRVFLVEDSGKKISPWHDIPLQLGDGVFNFVVEIPKESSA
KMEVATDEPFTPIKQDTKKGNLRYYPYNIHWNYGLLPQTWEDPSFANSEVEGAFGDNDPV
DVVEIGESRRQIGEILKVKPLAALAMIDEGELDWKIIAVSLDDPKASLVNDIDDMSRAWM
TIFDCSRDGIV
Download sequence
Identical sequences Eucgr.G01119.1|PACid:23586732 XP_010068328.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]