SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010069280.1.83385 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010069280.1.83385
Domain Number 1 Region: 304-413
Classification Level Classification E-value
Superfamily ApaG-like 5.1e-23
Family ApaG-like 0.00066
Further Details:      
 
Domain Number 2 Region: 11-72
Classification Level Classification E-value
Superfamily F-box domain 0.000000523
Family F-box domain 0.0073
Further Details:      
 
Domain Number 3 Region: 108-147,182-224
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000183
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010069280.1.83385
Sequence length 417
Comment PREDICTED: F-box protein SKIP16 isoform X2 [Eucalyptus grandis]; AA=GCF_000612305.1; RF=representative genome; TAX=71139; STAX=71139; NAME=Eucalyptus grandis; cultivar=BRASUZ1; AL=Scaffold; RT=Major
Sequence
MELESVGDLALNLILTKLGPENVGRVACVNRKLRLSADEEALWSRFCSEELHLSAPLDPR
GDPLPSFKAAYKKWREDFRMYPWPLVKRVKRCWDRLQGWLLTNFPDAAATLREGASEADI
QELESVLRVKLPLPTRILYRFHDGQDFDESDFTENTPGGSLGIIGGYSFYGYVVNVNLLP
LSKVIMETNHVVQHLGFSSRSNYIVVAASSTSGEKLFFLNCRDGQLHVGTRNLPFDGEMM
PCVPKSLISSVHDRNADLQQDAMLLWLEEHGRRLQSGMIKLREDGGVRSICLFPEEPPLC
STAITNGVRIRSSAVFVPEHSDLQNEYLFAYSIRMSLIPEGCMANEMPCNFCQLYRRHWI
IRANDAVVAHVNGDGAIGKFPLLHSGGKEFVYESCTHLKSPRGSIEGAFTFVPGSLT
Download sequence
Identical sequences A0A059AUP0
Eucgr.H00342.2|PACid:23589694 XP_010069280.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]