SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010130530.1.100080 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010130530.1.100080
Domain Number 1 Region: 3-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 2 Region: 70-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000137
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 3 Region: 126-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000318
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 4 Region: 174-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000101
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010130530.1.100080
Sequence length 207
Comment PREDICTED: netrin-G1-like, partial [Buceros rhinoceros silvestris]; AA=GCF_000710305.1; RF=representative genome; TAX=175836; STAX=175835; NAME=Buceros rhinoceros silvestris; AL=Scaffold; RT=Major
Sequence
NRCKCNLHATGCKEENKRLLCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANIC
IPSISSIGNCECFGHSNRCSYIELLNTVICVSCKHNTRGQHCELCRLGYFRNASAELDDE
NVCIDCYCNPFGSVHDRCNDRGFCECKEGTSGPKCDKCLPGYIWHSLGCQPNVCDNELLH
CQNGGTCVNNVRCQCPPAYTGILCEKL
Download sequence
Identical sequences XP_010130530.1.100080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]