SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010307645.1.13389 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010307645.1.13389
Domain Number 1 Region: 125-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000273
Family EGF-type module 0.013
Further Details:      
 
Domain Number 2 Region: 3-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000157
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 3 Region: 48-90
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000385
Family EGF-type module 0.027
Further Details:      
 
Domain Number 4 Region: 87-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000138
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010307645.1.13389
Sequence length 173
Comment PREDICTED: slit homolog 1 protein-like, partial [Balearica regulorum gibbericeps]; AA=GCF_000709895.1; RF=representative genome; TAX=100784; STAX=925459; NAME=Balearica regulorum gibbericeps; AL=Scaffold; RT=Major
Sequence
RDCEVALSTCSSNPCANGGTCQPQEGEGAGFRCLCPVGFEGPSCHSTSDPCKEHSCENGG
SCVPSATNYTCLCPARYTGDFCEQPPDFCSAELSPCQHGSTCISTSQGPRCECAPGYVGS
NCSEDFDDCQDHRCQNNARCLDEVNGYSCLCNEGYSGQLCEMPPRAAGQPGLC
Download sequence
Identical sequences XP_010307645.1.13389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]