SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010311922.1.13389 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010311922.1.13389
Domain Number 1 Region: 278-374
Classification Level Classification E-value
Superfamily Immunoglobulin 7.25e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 438-724
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 1.7e-19
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.038
Further Details:      
 
Domain Number 3 Region: 11-79
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000374
Family Ovomucoid domain III-like 0.0088
Further Details:      
 
Domain Number 4 Region: 199-291
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000953
Family I set domains 0.028
Further Details:      
 
Domain Number 5 Region: 124-196
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000182
Family Calmodulin-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010311922.1.13389
Sequence length 786
Comment PREDICTED: follistatin-related protein 4, partial [Balearica regulorum gibbericeps]; AA=GCF_000709895.1; RF=representative genome; TAX=100784; STAX=925459; NAME=Balearica regulorum gibbericeps; AL=Scaffold; RT=Major
Sequence
LYGQDGLHASCEKKYCGRGSKCVVNKDTDQPECRCVEDCKSSYMPVCGSDGKFYENHCQL
HRASCLQRKKIYIIHSKDCFFKGDTCTMADYSRLKSILLDLQAHRQSPPSSPAEDRVSQK
RFLVENMFKHLDVNSDGHLSSSELAQLMKKEDLEDDLLDCTLEDLLRFDDYNNDGRLTLQ
ELYTAFQVVRLSLPEDQKISVTTITVGLSTVLTCSIRGALRPPIIWKRNGVILNFLDLED
INDFGEDDSLYITKVTTIHMGNYTCHAYGYEELYQTHILQVNVPPVIRVYPETQAQEPGV
SASLKCHAEGIPNPRITWLKNGIDIVPKLSKQLTLLANGSELHISSVRYEDTGAYTCIAK
NEVGVDEDISSLFIEDSARKTLANILWREEGLSVGNMFYVFSDDGITVLQPNECEIRRHI
RPEERIFTSYEEICPRVEGEGTQSCLWASAVNVRDKYIYVTQPKQNRVMIIDIQTQKAVQ
SLAVDPLPTKLHYDKSHDQVWVLSWGDMRKSSPTLQVIPEASAGEDQHVIRTPFEGVDDF
FIPPTNLIINHVRFGFIFNKSKSAVHKIDLETVTHIKTINFKNYSCVPQTMAYTHLGGYF
FVQCRRNRSVAASPQLVIDSVTDAVIGPNSDVSGTPYISPDGRYLVSADEDSGRIKVQAL
SVRGEIKLIYDLQTNIHVSDLTFQPSFTEGNQYYIYATSHLQTDVLFVELSTGKMNVLKN
LKDPITSKDWPWSNYNRIMKDSGLFGQYLITPAKDSLFVINGRQNTLRCEVSGIRRGNTV
VWVGEV
Download sequence
Identical sequences XP_010311922.1.13389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]