SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010320464.1.44838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010320464.1.44838
Domain Number 1 Region: 803-896
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.23e-23
Family PB1 domain 0.0021
Further Details:      
 
Weak hits

Sequence:  XP_010320464.1.44838
Domain Number - Region: 207-289
Classification Level Classification E-value
Superfamily GAF domain-like 0.00216
Family GAF domain 0.011
Further Details:      
 
Domain Number - Region: 580-629
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0836
Family FIS-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010320464.1.44838
Sequence length 912
Comment PREDICTED: protein NLP4 isoform X1 [Solanum lycopersicum]; AA=GCF_000188115.3; RF=representative genome; TAX=4081; STAX=4081; NAME=Solanum lycopersicum; cultivar=Heinz 1706; AL=Chromosome; RT=Major
Sequence
MDERVIPSNPLLTTPSDYLMDLDYMDGLFLEGCWLETTDGNEFLQHSPGIFNAPFDSSFM
WPTTIDANNVEFNGISSKDAQQEKQRPSLTENLSINHCQELNYAKVQSFGENMNNAMCTS
SLSENHLVEAHELNKRWWIGPKASSSVMDRLIWALGYIRDCSRDKDILLQLWVPINRDGR
RVLSTTNQPFLLDLNCPQLANYREVSVNYQFPANEDSKEIVGLPGRVFADKVPEWTPDVR
FFRSEEYPRVEHAQQYDVRGTLAVPVFEQGSRNCLGVIEVVMTTQKIKYRSELESVCKAL
EAVDLSTSEVSTTQDAKVCDLSYQAALPEVLEVLKSACETHGLPLAQTWVPCIQQGKGGC
RHSQENLIHCVSTEDSACYVADPRVQGFHDACSEHHLLKGQGVVGRAFNTNQPCFSADLT
SYSKSEYPLSHYAKMFGLQAAVAIRLRSISTGSSDFVLEFFLPSDCRNPEDHRKMLTSLS
IIIQNVCRTLRVVTDKELQEETISVGEMANHTVEQHKEHTETSQERTSWTSCDAEFQESS
VMSTFQDEKPDEMLRKDSVEFRHRKNSAYEEGVSRNLGKTGDRRRAKAEKTITLQVLQQY
FAGSLKDAAKSIGVCPTTLKRICRQHGIKRWPSRKIKKVGHSLQKIQRVIDSVQGASGTL
QIESFYSNFPELASPNASRMSPFADSKSNEHPTALNTQQERCITSPNPDASKSPSSSSSR
SSSSSQCCSSGTKPQSPQSHPLSIVGDEDLIVQEESVDNAVKRVKSEPELHLSSEALKTI
PRSQSHLCVAENPISENLVLKRSPSTSQEEAPRVKVTHGEEKIRFRMQNSWRYNDLLREI
TRRFGIDDPSGLQLKYLDDDSEWVLLTCDADLEECIDVCMSSQIQMIKLILVQDSQHHFG
SSFGSSSPILVQ
Download sequence
Identical sequences K4BVX5
XP_004238434.1.44838 XP_010320461.1.44838 XP_010320462.1.44838 XP_010320463.1.44838 XP_010320464.1.44838 Sopim04g082480.0.1 Solyc04g082480.2.1 Solyc04g082480.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]