SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010335900.1.74449 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010335900.1.74449
Domain Number 1 Region: 131-197
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000496
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000179
Further Details:      
 
Domain Number 2 Region: 199-285
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000152
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010335900.1.74449
Sequence length 454
Comment PREDICTED: fragile X mental retardation syndrome-related protein 1 isoform X4 [Saimiri boliviensis boliviensis]; AA=GCF_000235385.1; RF=representative genome; TAX=39432; STAX=27679; NAME=Saimiri boliviensis boliviensis; AL=Scaffold; RT=Major
Sequence
MMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTVDVPEDLREACANEN
AHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLMSRNEEA
TKHLECTKQLAAAFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIY
GESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEGDNENK
LPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKEVEQLRMERLQIDEQLRQIGSRSYSG
RGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGR
GRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLLDNTESDQTADTDASESHHSTNRRRR
SRRRRTDEDAVLMDGMTESDTASVNENGLGKRCD
Download sequence
Identical sequences A0A2J8L6W2 A0A2J8WGW0 E7EU85 F7I1J4
XP_010335900.1.74449 XP_016862790.1.92137 ENSCJAP00000023572 ENSP00000420515 ENSP00000420515 ENSMMUP00000038775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]