SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010344223.1.74449 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010344223.1.74449
Domain Number 1 Region: 150-327
Classification Level Classification E-value
Superfamily MIR domain 7.5e-51
Family MIR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 939-1052
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-18
Family SPRY domain 0.029
Further Details:      
 
Domain Number 3 Region: 3823-3901
Classification Level Classification E-value
Superfamily EF-hand 0.000000000741
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 4 Region: 517-665
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000594
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 34-115
Classification Level Classification E-value
Superfamily MIR domain 0.00000314
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 353-480
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000262
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 2005-2070
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000942
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010344223.1.74449
Sequence length 4794
Comment PREDICTED: ryanodine receptor 2 [Saimiri boliviensis boliviensis]; AA=GCF_000235385.1; RF=representative genome; TAX=39432; STAX=27679; NAME=Saimiri boliviensis boliviensis; AL=Scaffold; RT=Major
Sequence
MLANTVEKSEGQVDVEKWKFMMKTAQGGGHRTLLYGHAILLRHSYSGMYLCCLSTSRSST
DKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNGS
LHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHMDECLTVPSGEHGEEQRRTV
HYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKNLLLMDKE
KADVKSTAFTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSVCYIQHVDTGLWLTYQSVDAK
SVRMGSIQRKAIMHHEGHMDDGINLSRSQHEESRTARVIRSTVFLFNRFIRGLDALSKKA
KPSTVDLPIESVSLSLRDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLE
CIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCAQFSGSLDWLIS
RLERLEASSGMFSSFLLVSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRV
GWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVI
SCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLP
PPGYAPCYEAVLPKEKLKVEHSREYKQERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLP
PHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQM
SLETLKTLLALGCHVGISDEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAM
VDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVR
TLLGYGYNLEAPDQDHAARAEVCSGTGERFRIFRAEKTYAVKAGRWYFEFEAVTAGDMRV
GWSRPGCQPDQELGSDERAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMF
TLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEG
YEPFAVNTNRDITMWLSKRLPQFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNS
NTDIMFYRLSMPIECAEVFSKTVPGGLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLV
PDRVDKDKEATKPEFNNHKDYAQEKPSRLKQRFLLRRTKPDYSTSHSARLTEDVLADDRD
DYDFLMQTSTYYYSVRIFPGQEPANVWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGK
VHESIKRSNCYMVCAGESMSPGQGRNNNGLEIGCVVDAASGLLTFIANGKELSTYYQVEP
STKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVL
WSRMPNQFLKVDVSRISERQGWSVQCLDPLQFMSLHIPEENRSVDILELTEQEELLKFHY
HTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYA
TARLMMNNEYIVPMTEETKSITLFPDENKKHGLPGIGLSTSLRPRMQFSSPSFVSISHEC
YQYSPEFPLDILKAKTIQMLTEAVREGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFH
NEDLKHILQLIEPSVFKEAATPEEESDKLEKELSVEDAKLQGAGEEEAKGGKRPKEGLLQ
MKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSA
ALTARKTKEFRSPPQEQINMLLNFKDDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDG
SLDGSSDLTIRGRLLSLVEKVTYLKKKQAEKPIESDSGKSSTLQQLISETMVRWAQESVI
EDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMG
KEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEITFPKMVAN
CCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDNNELAL
ALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEE
NANVVVRLLIRRPECFGPALRGEGGNGLLAAMEEAIKIAEDPSRDGPSPTSGSSKTLDTE
EEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGV
ISIAFQMPTIAKDGNVVEPDMSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPD
LRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRL
SKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYE
RCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGA
LPPDYMESNYVSMMEKQSSMDSEGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMD
KLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREG
DSMALYNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKK
KKMELESKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQINGYAVSRGFKDLDLDTP
SIEKRFAYSFLQQLIRYVDEAHQYILEFDGGSRGKGEHFPYEQEIKFFAKVVLPLIDQYF
KNHRLYFLSAASRPLCSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHI
LGQTLDARTVMKTGLESVKSALRAFLDSAAEDLEKTMENLKQGQFTHTRNQPKGVTQIIN
YTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQRSAL
GECLAAFAGAFPVAFLETHLDKHNIYSIYNTKSSRERAALSLPSNVEDVCPNIPSLEKLM
EEIVELAESGIRYTQIPHVMEVILPMLCSYMSRWWEHGPENNPERAEMCCTALNSEHMNT
LLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVS
EEDHLKAEARGDMSEAELLILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEEL
FRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITDTKSKMSKAAVSDQERKKMKRK
GDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRFSLKDTEDEVRDIIRSNIHL
QGKLEDPAIRWQMALYKDLPNRTDDTSDPEKTVERVLDIANVLFHLEQVEHPQRSKKAVW
HKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLACH
NCMETNGHPKCSGYKLEEDFLYMAYADIMAKSCHDEEDNDGEEEVKSFEEKEMEKQKLLY
QQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKD
VGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLL
CEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNF
SKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIE
LLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDL
TSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKR
FHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIE
RVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQI
SESDLNERSANKEESEKERPEEQGPRMGFFSILTVKSALFALRYNILTLMRMLSLKSLKK
QMKKVKKMTVKDMVTAFFSSYWSIFLTLLHFVASVFRGFFRIICSLLLGGSLVEGAKKIK
VAELLANMPDPTQDEVRGDGEEGERKPLEAALPSEDLTDLKELTEESDLLSDIFGLDLKR
EGGQYKLIPHNPNAGLSDLMSNPVPMPAVQEKFQEQKAKEEGKEEREETKSEPEKAEGED
GEKEEKVKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFYNMRMLA
LFVAFAINFILLFYKMQQTDSTLNGLNQVSTSSVVEGRELPTRSSSENAKVTSLDSSSHR
IIAVHYVLEESSGYMEPTLRILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFD
GLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMD
KAALDFSDAREKKKPKKDSSFSAALNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGH
YNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFY
NKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFF
VIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEH
NLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences XP_010344223.1.74449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]