SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010355184.1.97406 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010355184.1.97406
Domain Number 1 Region: 277-437
Classification Level Classification E-value
Superfamily eEF1-gamma domain 2.75e-72
Family eEF1-gamma domain 0.000000016
Further Details:      
 
Domain Number 2 Region: 82-235
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.06e-38
Family Glutathione S-transferase (GST), C-terminal domain 0.0022
Further Details:      
 
Domain Number 3 Region: 1-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.32e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010355184.1.97406
Sequence length 437
Comment PREDICTED: elongation factor 1-gamma [Rhinopithecus roxellana]; AA=GCF_000769185.1; RF=representative genome; TAX=61622; STAX=61622; NAME=Rhinopithecus roxellana; AL=Scaffold; RT=Major
Sequence
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPA
FEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGI
MHHNKQATENAKEEVRRILGLLDAHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSF
RQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREE
KQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNE
DTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASV
ILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWE
GAFQHVGKAFNQGKIFK
Download sequence
Identical sequences A0A1D5QT60 A0A2K5MZM9 A0A2K5XPG1 A0A2K6E797 A0A2K6QBW1 Q4R7H5
9544.ENSMMUP00000008675 NP_001182509.1.72884 XP_005577643.1.63531 XP_010355184.1.97406 XP_011718762.1.29376 XP_011848758.1.47321 XP_011897456.1.92194 XP_011909127.1.92194 ENSMMUP00000008675 ENSMMUP00000008675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]