SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010359508.1.97406 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010359508.1.97406
Domain Number 1 Region: 166-362
Classification Level Classification E-value
Superfamily E set domains 1.31e-73
Family Cytoplasmic domain of inward rectifier potassium channel 0.000002
Further Details:      
 
Domain Number 2 Region: 49-181
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.16e-22
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010359508.1.97406
Sequence length 424
Comment PREDICTED: ATP-sensitive inward rectifier potassium channel 8 [Rhinopithecus roxellana]; AA=GCF_000769185.1; RF=representative genome; TAX=61622; STAX=61622; NAME=Rhinopithecus roxellana; AL=Scaffold; RT=Major
Sequence
MLARKSIIPEEYVLARIAAENLRKPRIRDRLPKARFIAKSGACNLAHKNIREQGRFLQDI
FTTLVDLKWRHTLVIFTMSFLCSWLLFAIMWWLVAFAHGDIYAYMEKSGMEKSGLESTVC
VTNVRSFTSAFLFSIEVQVTIGFGGRMMTEECPLAITVLILQNIVGLIINAVMLGCIFMK
TAQAHRRAETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQVVKKTTTPEGEV
VPIHQLDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYDISATDLANQDLEVIVILEGVV
ETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDE
KPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQN
TSES
Download sequence
Identical sequences A0A024RAV6 A0A0D9R6G0 A0A2K5K4E1 A0A2K6N336 A0A2K6QA04 G1QYC3 G3R0Q9 H2NGT3 H2Q5L2 Q15842
9598.ENSPTRP00000008130 9600.ENSPPYP00000004977 9606.ENSP00000240662 gi|4826802|ref|NP_004973.1| ENSP00000240662 ENSGGOP00000008753 NP_004973.1.87134 NP_004973.1.92137 XP_001149700.1.37143 XP_002823064.1.23681 XP_003265638.1.23891 XP_003828939.1.60992 XP_004052906.1.27298 XP_005253415.1.92137 XP_007966067.1.81039 XP_007966068.1.81039 XP_008952575.1.60992 XP_009424026.1.37143 XP_010359505.1.97406 XP_010359506.1.97406 XP_010359507.1.97406 XP_010359508.1.97406 XP_011810517.1.43180 XP_016874772.1.92137 XP_016874773.1.92137 XP_017744120.1.44346 XP_017744121.1.44346 XP_017744122.1.44346 XP_017744123.1.44346 XP_017744124.1.44346 ENSP00000240662 ENSPPYP00000004977 ENSP00000240662 ENSNLEP00000005944 ENSNLEP00000005944 ENSPTRP00000008130 ENSPPYP00000004977 ENSGGOP00000008753 ENSPTRP00000008130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]