SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010363308.1.97406 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010363308.1.97406
Domain Number 1 Region: 2206-2299
Classification Level Classification E-value
Superfamily C-type lectin-like 1.83e-33
Family Link domain 0.00012
Further Details:      
 
Domain Number 2 Region: 506-644
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-30
Family FAS1 domain 0.0015
Further Details:      
 
Domain Number 3 Region: 1470-1518,1599-1710
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-28
Family FAS1 domain 0.003
Further Details:      
 
Domain Number 4 Region: 1712-1865
Classification Level Classification E-value
Superfamily FAS1 domain 1.18e-25
Family FAS1 domain 0.004
Further Details:      
 
Domain Number 5 Region: 962-1119
Classification Level Classification E-value
Superfamily FAS1 domain 2.88e-21
Family FAS1 domain 0.0048
Further Details:      
 
Domain Number 6 Region: 383-496
Classification Level Classification E-value
Superfamily FAS1 domain 3.27e-21
Family FAS1 domain 0.0037
Further Details:      
 
Domain Number 7 Region: 2297-2460
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-17
Family FAS1 domain 0.0095
Further Details:      
 
Domain Number 8 Region: 1137-1228
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000183
Family FAS1 domain 0.0081
Further Details:      
 
Domain Number 9 Region: 1542-1579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family Merozoite surface protein 1 (MSP-1) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010363308.1.97406
Sequence length 2567
Comment PREDICTED: stabilin-1 isoform X2 [Rhinopithecus roxellana]; AA=GCF_000769185.1; RF=representative genome; TAX=61622; STAX=61622; NAME=Rhinopithecus roxellana; AL=Scaffold; RT=Major
Sequence
MAGPQGLLPLCLLAFCLAVFIRGQVLFKGCDVKTTFVTHVPCTSCAAIKKQTCPSGWLRE
LPDQITQDCRYEVQLGGSMVSMSGCRRKCRKQVVQKACCPGYWGSRCYECPGGAETPCNG
HGTCLDGMDRNGTCVCQENFRGSACQECQDPNRFGPDCQSVCSCVHGVCNHGPRGDGSCL
CFAGYTGPHCDQELPICQELRCPQNTQCSAEAPSCRCLPGYTQQGSECRAPNPCWPSPCS
PLAQCSVSPKGQAQCHCPENYHGDGMVCLPKDPCTDNLGGCPSNSTLCVYQKPGQAFCTC
RPGLISINNNASAGCFPFCSPFSCDRSATCKATADGKTSCVCRESEVGDGRACYGHLLHE
VQKATQTGRVFLQLRVAVAMMDQGCREILTTAGPFTVLVPSISSFSSRTMNASLAQQLCR
QHIIAGQHILEDTRTQQTRRWWTLAGQEITVTFNQFTKYSYKYKDQPQQTFNIYKANNIA
ANGVFHVVTGLRWQPPSGTPGDPKRTIGQILASTEAFSRFETILENCGLPSILDGPGPFT
VFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVEKLISKGRILTMANQV
LAVNISEEGRILLGPEGVPLQRVDVLAANGVIHMLDGILLPPTILPILPKHCSEEQHKIV
AGSCVDCQALNTSMCPHNSVKLDIFPKECVYIHDPTGLNVLKKGCASYCNQTVTEQGCCK
GFFGPDCTQCPGGFSNPCYGKGNCSDGIQGNGACLCFPDYKGIACHICSNPNKHGDQCQE
DCGCVHGLCDNRPGSGGVCQQGTCAPGFSGRFCNESMGDCGPTGLAQHCHLHARCVSQEG
VARCRCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGSLGTHHCTCHKGWSGDGRVC
VAIDECELDVRGGCHADALCSYVGPGQSRCTCKLGFAGDGYQCSPIDPCRAGNGGCHGLA
TCRAVGGGQRVCTCPPGFGGDGFSCYGDIFWELEANAHFSVFYQWFKSAGITLPADRQVT
ALVPSEAAVRQLNPEERAFWLQPRMLPSLVRAHFLQGALFEEELARLGGQEVATLNPTTR
WEIRNISGRVWVQNASVDVADLLATNGVLHILSQVLLPPRGDVPSGQGLLQQLDLVPAFS
LFRELLQRHRLVSQIEAATAYTIFVPTNRSLEAQGNSSHLDADTVRHHVVLGEALSMETL
RKGGHRNSLLGPAHWIVFYNHSGQPEVNHVPLEGPMLEAPGRSLIGLSGVLTVGSSRCLH
SHAEALREKCVNCTRKFRCTQGFQLQDTPRKSCVYRSGFSFSRGCSYTCAKKIQVPDCCP
GFFGTLCEPCPGGLGGVCSGHGQCQDRFLGSGECHCHEGFHGTACEMCELGRYGPNCTGV
CDCAHGLCQEGLQGDGSCVCNVGWQGLRCDQKITSPQCPRKCDPNANCVQDSAGASTCAC
AAGYSGNGVFCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYMGDGELCQEINSCL
IHHGGCHIHAECIPTGPQQVSCSCRQGYSGDGIRTCELLDPCSKNNGGCSPYATCKSTGD
GQRTCTCDTANTVGDGLTCRARVGLELLRDKHASFFSLRLLEYKELKGDGPFTIFVPHAD
LMSNLSQDELARIRAHRQLVFRYHVVGCRRLRSEDLLEQGYATALSGHPLRFSEREGSIY
LNDFARVVSSDHEAVNGILHFIDRVLLPPDALHWEPDDEPIPRRNVTAAAQGFGYKIFSG
LLKVASLLPLLREASHRPFTMLWPTDAAFRALPPDRQAWLYHEDHRDKLAAILRGHMIRN
VEALASDLPNLGPLRTMHGTPVSFSCSRMRPGELMVGEDDARIVQRHLPFEGGLAYGIDQ
LLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQGSPEACWRFYPKFWTSPPLR
SLGLRSVWVQHSLWARPQGLGRGCHRNCVTTTWKPSCCPGHYGSECQACPGGPSSPCSDR
GMCMDGMSGSGQCLCHSGFAGTACELCAPGAFGPHCQACRCTVHGRCDEGLGGSGSCFCD
EGWTGSHCEVQLELQPVCTPPCAPKAVCRAGNSCECSLGYEGDGRMCTVADLCQDGHGSC
SEHANCSQVGTAVTCTCLPDYEGDGWSCRARNPCTDGHRGGCSEHADCLSTGLNTRRCEC
HAGYVGDGLQCLEELEPPVDRCLGQPPPCHSDAVCTDLHFQEKRAGVFHLQATSGPYGLN
FSEAEAACKAQGAVLASFPQLSAAQQLGFHLCLMGWLANGSAAHPVVFPVADCGNGRVGI
VSLGARKNLSERWDAYCFRVQDVACRCRDGFVGDGISTCNGKLLDVLAATANFSTFYGML
LGYANATQRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATLLSANAS
QGKLLPAHSGLSLIISDAGPDNSSWAPVAPGTVVVSHVIVWDIMAFNGIIHVLASPLLAP
PQPAVLAPEAPPVAAGVGAVLAAGALLGLVAGALYLRARVKPTGFGFSAFQAEEDAADDF
SPWQEGTNPTLVSVPNPVFGSDTFCEPFNDSLLEEDFPDTQRILTVK
Download sequence
Identical sequences XP_010363308.1.97406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]