SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010364180.1.97406 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010364180.1.97406
Domain Number 1 Region: 3-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.04e-48
Family Phosducin 0.0000000612
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010364180.1.97406
Sequence length 194
Comment PREDICTED: phosducin isoform X2 [Rhinopithecus roxellana]; AA=GCF_000769185.1; RF=representative genome; TAX=61622; STAX=61622; NAME=Rhinopithecus roxellana; AL=Scaffold; RT=Major
Sequence
MSSPQSRNGKDSKERVSRKMSIQEYELIHKEKEDENCLRKYRRQCMQDMHQKLSFGPRYG
FVYELETGEQFLETIEKEQKITTIVVHIYEDGIKGCDALNSSLTCLAAEYPIVKFCKIKA
SNTGAGDRFSLDVLPTLLIYKGGELISNFISVADQFAEEFFAGDVESFLNEYGLLPEREV
HALEHTKIEEEDIE
Download sequence
Identical sequences A0A1D5Q2N8 A0A2K6PHP6
XP_010364180.1.97406 XP_011744727.1.29376 XP_011854549.1.47321 ENSMMUP00000037954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]