SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010365572.1.97406 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010365572.1.97406
Domain Number 1 Region: 228-480
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-72
Family Protein kinases, catalytic subunit 0.000000107
Further Details:      
 
Domain Number 2 Region: 117-252
Classification Level Classification E-value
Superfamily SH2 domain 1.08e-31
Family SH2 domain 0.00000137
Further Details:      
 
Domain Number 3 Region: 51-140
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000499
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010365572.1.97406
Sequence length 507
Comment PREDICTED: megakaryocyte-associated tyrosine-protein kinase [Rhinopithecus roxellana]; AA=GCF_000769185.1; RF=representative genome; TAX=61622; STAX=61622; NAME=Rhinopithecus roxellana; AL=Scaffold; RT=Major
Sequence
MAGRGSLLSWRAFHGCDSAKELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHT
RPKPGELAFRKGDVVTILEACENKSWYRVKHHTSGQEGLLAAGALREREALSTDPKLSLM
PWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTI
DEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQ
IGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHKNLVRLLGVILHQGL
YIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILV
SEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSY
GRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLAR
ELRSAGAPASVSGQDTDGSTSPRSQEP
Download sequence
Identical sequences A0A0A0MVW3 A0A2K5MSS3 A0A2K5UQL7 A0A2K6DVP9 A0A2K6JNP6 A0A2K6QP11 H9FUH6
XP_005587590.1.63531 XP_007992992.1.81039 XP_007992993.1.81039 XP_010365572.1.97406 XP_011746080.1.29376 XP_011746087.1.29376 XP_011746091.1.29376 XP_011928466.1.92194 XP_017702736.1.44346 ENSPANP00000007963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]