SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010368557.1.97406 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010368557.1.97406
Domain Number 1 Region: 21-71
Classification Level Classification E-value
Superfamily SAICAR synthase-like 0.000000000017
Family Inositol polyphosphate kinase (IPK) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010368557.1.97406
Sequence length 97
Comment PREDICTED: inositol hexakisphosphate kinase 2 isoform X3 [Rhinopithecus roxellana]; AA=GCF_000769185.1; RF=representative genome; TAX=61622; STAX=61622; NAME=Rhinopithecus roxellana; AL=Scaffold; RT=Major
Sequence
MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMR
KFTPQYKGQSQRPLVSCPSLPHFFPWSFPLWPQGSVA
Download sequence
Identical sequences A0A2K5LD33 I2CT80
XP_005547108.1.63531 XP_005547109.1.63531 XP_010368557.1.97406 XP_010368565.1.97406 XP_011794527.1.43180 XP_011794528.1.43180 XP_011888985.1.92194 XP_011888986.1.92194 XP_014986464.1.72884 XP_014986465.1.72884 XP_017723642.1.44346 XP_017723643.1.44346 XP_017723644.1.44346 ENSMMUP00000019331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]