SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010371463.1.97406 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010371463.1.97406
Domain Number 1 Region: 1188-1265
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 802-875
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000114
Family V set domains (antibody variable domain-like) 0.071
Further Details:      
 
Domain Number 3 Region: 585-638
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 1083-1163
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000255
Family I set domains 0.034
Further Details:      
 
Domain Number 5 Region: 298-358
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000536
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 353-413
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 450-504
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 8 Region: 638-698
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000379
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 9 Region: 1305-1362
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000116
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 
Domain Number 10 Region: 694-759
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 11 Region: 1364-1423
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000209
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 12 Region: 1478-1534
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000916
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Domain Number 13 Region: 220-280
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000314
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 14 Region: 526-582
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000458
Family TSP-1 type 1 repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010371463.1.97406
Sequence length 1571
Comment PREDICTED: ADAMTS-like protein 3, partial [Rhinopithecus roxellana]; AA=GCF_000769185.1; RF=representative genome; TAX=61622; STAX=61622; NAME=Rhinopithecus roxellana; AL=Scaffold; RT=Major
Sequence
DCPPDAEDFRAQQCSAYNDVQYQGHYYEWLPQYNDPGAPCALRCHARGQNLVVELAPKVL
DGTRCNTDSLDMCISGICQAVGCDRQLGSNAKEDNCGVCAGDGSTCRLVRGQSKSHVSPE
KREENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKGEHSFNSPGVFVVENTTVEFQRG
SERQTFKIPGPLMADFIFKTRYTAAKDSVVQFFFYQPISHQWRQTDFFPCTVTCGGGYQL
NSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLPR
WEHNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCPK
WIAMEWSQCTVTCGRGLRYRVVLCINHRGEHVGGCNPQLKLHIKEECVIPIPCYKPKEKS
PVEAKLPWLKQAQELEETRIATEEPTFIPEPWSACSTTCGPGVQVREVKCRVLLTFTQTE
TELPEEECEGPKLPTERPCLLEACDESLASRELDIPLPEDSEMTYDWEYAGFTPCTATCL
GGHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHMGSWGPCSATCGV
GIQTRDVYCLHPGETPAPPEECRDEKPHALQACSQFDCPPGWHIEEWQQCSRTCGGGTQN
RRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPHLAVGDWSKCSVSCGVGIQR
RKQVCQRLTAKGRRVPLSEMMCRDLPGLPLVRSCQMPECSKIKSEMKTKLGEQGPQILSV
QRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGHCLQNSKRLGI
TKSGSLKIHSLATPDIGVYRCIAGSAQETVVLKLIGTDNRLIARPTLREPMREYPGMDHN
EANNLGVTWHKMRQMWNNKNDLYLDDDYISNQPFLRALLGHCSSSAGNTNSWELKNKQFE
AAVKQGAYSMDTAQFDELIRNMSQLMETGEVSDDLASQLIYQLVVELAKAQPTHMQWWGI
QEEMPPAAQLRGETGSVSQSSNAKNSGKLTFKLKRPVLMRQSQPPSISFNKTINSRIGNT
VYITKRTEVINILCDLITPGEATYTWTKDGTLLQPSVKIILDGTGKIQIQNPTRKEQGIY
ECSVANHLGSDVESSSVLYAEAPVILSIERNITKPEHNHLSVMVGGIVEAALGANVTIRC
PVKGVPQPNITWLKRGGSLSGNVSLLFNGSLLLQNVSLENEGTYVCTATNALGKAVATSV
LHLLERRWPESKIVFPQGHKKYVLQATNTRTNSSDPTGEPLPQEPFWEPGNWSHCSATCG
HLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFQPCNIWDCPARWFTSMWSQCSVSCGE
GYHSRQVMCKQTKANGTVQVVSPRACAPKDRPLGRKPCFGHPCVQWEPGNQCSGRCMGHA
VRMHQHHTACQHNGSDSNCDDRRRPTFRRNCTSGACDVCWHTGPWKPCTAACGRGLQSRK
VDCIHTRSCKPVAERHCVQKKKPVSWRHCLGPSCDSTYTSQTSTNKGAASHVKRDKPLEG
SRCCCEDKSRI
Download sequence
Identical sequences A0A2K6PJG7
XP_010371463.1.97406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]