SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010382605.1.97406 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010382605.1.97406
Domain Number 1 Region: 282-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-21
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 393-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.74e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 497-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.69e-20
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 5 Region: 435-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 38-95
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-18
Family KRAB domain (Kruppel-associated box) 0.0032
Further Details:      
 
Domain Number 7 Region: 539-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 8 Region: 626-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.99e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 9 Region: 173-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000455
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 10 Region: 230-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000115
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 11 Region: 598-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000441
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 12 Region: 117-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000037
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010382605.1.97406
Sequence length 683
Comment PREDICTED: putative zinc finger protein 840 [Rhinopithecus roxellana]; AA=GCF_000769185.1; RF=representative genome; TAX=61622; STAX=61622; NAME=Rhinopithecus roxellana; AL=Scaffold; RT=Major
Sequence
MSLTGHGEVEVLLYAVLLLKVPNCLSFSMQLPRGSERHQELVKFRDVAVVFSPDEWDHLN
PEQRNLYRDVMLDNCKYLASLACQPALATFRALSESGNAFRQSFHHGEYRTHRTFVQRYE
CDDCGMAFGHISQLTRHQKIHKVGEAHKHGENTKGFRHHSSFTILQRICMLYKHFECNQC
GETFNRPSQVIQHQSMHRGLKPYKCDACQKAFRFLSSLSIHQRFHVGNRLNLTWHQKTHT
QRKPFSCNFCGKTFPCFSEKTQHQLIHTRKKYYPCNYCEKEFNPYSKFILHQRTHTGEKP
HKCDVCEKSFKSISNLNKHQKTHTGEKPFSCNECKKTFAQRTDLARHQQIHTGKKSFICS
SCKKTFVRRSHLTQHQRTHTGERPYQCTTCEKTFKFRSNLTKHQKTHSIGRPFACNECGK
TFRLNGELNQHKKIHTGEKPYECGECGKRFNNNSNLNKHKKIHTGEKHFVCNQCGKAFNL
NSKLSRHQITHNKKGNSFKSISNLNKHQKTHAGEKPFSCNECKKTFAQCMDLARHQQIHT
GRKPFICSNCKKSFVRLSDLTQHQGTHTGERPYQCTTCEKTFKNRSNFTKHQTLSVGRSF
TCNECGKTFCLNWKLNQHKKIHTGEKSYECGECGKCFNNNSNLNKHKKIHTGEKHFVCNQ
CGKAFSLNSKLSRHQITHNKKKP
Download sequence
Identical sequences XP_010382605.1.97406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]