SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010571406.1.12557 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010571406.1.12557
Domain Number 1 Region: 19-531
Classification Level Classification E-value
Superfamily Sema domain 1.57e-98
Family Sema domain 0.0013
Further Details:      
 
Domain Number 2 Region: 1402-1527,1693-1850
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-36
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 965-1055
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000827
Family Other IPT/TIG domains 0.055
Further Details:      
 
Domain Number 4 Region: 875-955
Classification Level Classification E-value
Superfamily E set domains 0.000000000000255
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 5 Region: 534-586
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000262
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 1054-1137
Classification Level Classification E-value
Superfamily E set domains 0.00000000369
Family E-set domains of sugar-utilizing enzymes 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010571406.1.12557
Sequence length 1917
Comment PREDICTED: plexin-D1, partial [Haliaeetus leucocephalus]; AA=GCF_000737465.1; RF=representative genome; TAX=52644; STAX=52644; NAME=Haliaeetus leucocephalus; AL=Scaffold; RT=Major
Sequence
LLPLLPLLLPGRAASLEVQRKFLSPTPTNNFALDGPGSRVYLAAVNRLFQLSGGELALEA
EAAVGPVLDSPLCHAPQLPQASCEHPKVLTNNYNKILQPDPEQGVLVVCGSIYQGLCQLR
SMANISAVAVRFPPGGSDPVTVFPSMLNVAANHPNASTVGLVLRRGGGGARLLVAATYTG
FGSPFFPRNRSLEDHRFENTPEIAIRALNARGDLAKLFTFDINPSDDNIFKIKQGAKARH
KLSFVRAFLQRGAAPPARRPYAYLALNSEANAGDKESPSHSLLARICLGEAAEATLNGSG
ETKKLTESYIQLGLRCGGAADAFTRLVSVFPARAAWRSPAAPAPAPPPAEELLFGVFERA
GAGGGGGGRPQSALCVFRFAEIEETIRAARNSCFVSPGAGMVTVLDSVVQGTGPACEKRN
IQLQPEQLDCGAAHLQHPLAIVNPVTATPVFTYSGLTAVAVASINNYTVVFLGTASGGLL
KINLDSTMKVISRRSISVAYGEPVHPIMQFDPSDSTYLYLMTSYQMTRVKVAACNQYSTC
TECLAAADAYCGWCTMETRCSLQHECTNFTGANFWASASEGVQQCPSMTILEPEINIDKE
NPALIIQINGTIPNLNGTNISCDYGNNIHTVARVAGDYVNQFIYCSLLPREKYPAFPDDQ
DHVVVETALRVNSKNIIRANFTIYDCKRTGNIYPKRACTSCLSTRWKCHWCPSTYTCVSN
HSQCDDALQMKKKIDCPRIVPASLDPMPTGVSRDIMISLANTTFSKETALECHFGTDRTF
EARWVNSSAVECVHVLLHTSEKSHLFPVNLQLKDRPDRFIDSPEMMTVEVYNCATGSADC
SQCLGREDLGHRCVWSESSSSCRLHSEPSQVSDICPAPEIKKIEPLRGPLEGGTLLTIRG
RNLGRRFSDVLGAVRIGSVQCVPLPDRYVVSEAIVCQTGEAQEAFSDVVTVNVSREGKSR
ERYSYVLPVVQSIAPLNGPKAGGTRVTIRGSRLDVGSELRVLVNTSKQCTDLSRNDSTIT
CTMPSAELTTAVRVCVQFENKSCASYNITFKYEKNPIISDINPKKSQISGGRIITLEGRG
FELVQNVSMVVRGIGREQTSCKVHTDTVITCPSPAASNITAGSKPAPVDFYLNGRLYADD
RLALDEEMYPEEALHISKFSLEYYADPQFFTAKKEKWIKHHPGEPLTLVIHKEPDSLGLE
SNEYQVKIGLISCEIQIVSDKVIHCSVNESLSTSERQLPVTIQVGKFNYTIAMLHLGGGE
TAIIVSIVICSILLVLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAEL
QTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEECYILPSQQLSSQVGSQVQET
HPLLVGEWKIPENCRPNMEEGISLFSTLLNNKHFLIVFVHALEQQKDFAVRDRCNLASLL
TIALHGKLEYYTSIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLRE
TVGEPFFLLICAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMD
SLSVRAMDTDTLSQVKEKILEAFCKNVPYSQWPRVEDVDLEWFATSTDSYILRDLDDTSV
VEDGRKKLNTLAHYKIPEGASLAMSLSDKKDTTLSRVKDLDTEKYFHLVLPTDESVEHKK
SHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIRDDKPPVAVKYFFDFLEEQA
EKRGITDPDTMHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSL
SDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMPPLSEQEMNAHLAEESRKYRNEF
NTNVAMAEIYKYAKRYRSQIVAALDANPTTKRTQLQHKFEQVIALMEDNIYECCSEA
Download sequence
Identical sequences XP_010571406.1.12557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]