SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010586152.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010586152.1.64505
Domain Number 1 Region: 4-214
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-44
Family DBL homology domain (DH-domain) 0.00038
Further Details:      
 
Domain Number 2 Region: 202-330
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000142
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010586152.1.64505
Sequence length 331
Comment PREDICTED: rho guanine nucleotide exchange factor 39 isoform X2 [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
MESPDPSARCPLQEQRARWERKRACTARELLETERRYQEQLGLVATYFLGILRAKGTLRL
PERQVLFGPWELIYGASQDLLPHLEGGHWGQGLEGFCPHLQLYTQYAANADRSWTTLQEQ
LKKNKRFRRFVRLQEGRPEFGGLQLQDLLPLPLKRLQQYENLVVALAENTGPNSPDHQQL
TRAARLISETAQRVHAIGQRQKNDQHLQRVQALLSGRQAKGLITGRWFLHQGWLLVVPPH
GKPRPRMFFLFTDVLLMAKRRPPLHLLQSGTFACQALYPMAQCQLHRVFGHSGGPCGGLL
SLSFPHEKLLLMSTHQEELSRWYHSLTLAVR
Download sequence
Identical sequences G3TPG7
ENSLAFP00000017281 ENSLAFP00000017281 XP_010586152.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]