SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010586649.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010586649.1.64505
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000654
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010586649.1.64505
Sequence length 264
Comment PREDICTED: somatomedin-B and thrombospondin type-1 domain-containing protein [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
MRTLWLALCALARLWPGALAGCAEAGRCCPGRDPACFTHGWRLDRVYGTCFCDQACILTG
DCCFDYSRACPARPCIVGEWSPWSGCADQCKPTARIRRRPVRQEPQNGGAPCPPLEERAG
CLEYSTPQGQDCGHAFVPAFITTSAFNKERTRQAASPQWSTDTQDPGYCMEFKTESLTHH
CAMENRPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDTDGNQTLHWQAIGNPRC
QGTWKKVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences G3TFM3
ENSLAFP00000013140 XP_010586649.1.64505 ENSLAFP00000013140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]