SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010599504.1.64505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010599504.1.64505
Domain Number 1 Region: 153-349
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-38
Family SPRY domain 0.00029
Further Details:      
 
Domain Number 2 Region: 12-82
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000303
Family RING finger domain, C3HC4 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010599504.1.64505
Sequence length 352
Comment PREDICTED: RING finger protein 39 [Loxodonta africana]; AA=GCF_000001905.1; RF=representative genome; TAX=9785; STAX=9785; NAME=Loxodonta africana; AL=Scaffold; RT=Major
Sequence
MEAPALGSGLVERLEQLATCPLCGGPFKDPVLLACEHSFCRACLALRWGPPPATGTAATP
TACPCCGRPCPRRSLRSNVRLAVEVRISRGLCEKLAEPGARAVRRRGGRIPTMGWLDPPG
EDMRKTWSRFDAPMPKSPNSEDDLPEDYPVVKNMLHRLTADLTLDPGTAHRHLVISSDCR
SVRLAPPGTPAPPDSPARFDQLPAVLGAQGFGAGRHCWEVETTDTVSREDSSGEDEDDGE
SRYAVGAAGESVRRKGRVGLCPAGAVWAVEGRGGRLWALTAPEPTLLGGAGPPPRRIRVD
LDWERGRVAFYDGRSLDLLFAFQAPGPLGERVFPLLCTRDPRAPLRIVPAEG
Download sequence
Identical sequences G3TTF1
ENSLAFP00000018859 XP_010599504.1.64505 ENSLAFP00000018859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]