SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010639527.1.5607 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010639527.1.5607
Domain Number 1 Region: 475-637
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.7e-69
Family A middle domain of Talin 1 0.000000373
Further Details:      
 
Domain Number 2 Region: 737-872
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.96e-52
Family I/LWEQ domain 0.00000211
Further Details:      
 
Domain Number 3 Region: 642-766
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.1e-51
Family I/LWEQ domain 0.00000499
Further Details:      
 
Domain Number 4 Region: 1821-1955
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.65e-46
Family VBS domain 0.0000088
Further Details:      
 
Domain Number 5 Region: 2277-2481
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.54e-46
Family I/LWEQ domain 0.00015
Further Details:      
 
Domain Number 6 Region: 1208-1344
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.49e-41
Family VBS domain 0.028
Further Details:      
 
Domain Number 7 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 8.37e-32
Family Second domain of FERM 0.0000013
Further Details:      
 
Domain Number 8 Region: 1057-1190
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.24e-29
Family VBS domain 0.012
Further Details:      
 
Domain Number 9 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-24
Family Third domain of FERM 0.0000172
Further Details:      
 
Domain Number 10 Region: 1452-1538
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000118
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 11 Region: 1987-2114
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000377
Family VBS domain 0.013
Further Details:      
 
Domain Number 12 Region: 1679-1797
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000173
Family VBS domain 0.063
Further Details:      
 
Domain Number 13 Region: 81-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000115
Family Ubiquitin-related 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010639527.1.5607
Sequence length 2538
Comment PREDICTED: talin-2 isoform X3 [Fukomys damarensis]; AA=GCF_000743615.1; RF=representative genome; TAX=885580; STAX=885580; NAME=Fukomys damarensis; AL=Scaffold; RT=Major
Sequence
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETVEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGVTKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKAEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQALM
GTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVDAITAGTAS
VVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAALMDDEVGSGEDLLRAARTLA
GAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGENETDERFQDVLMSLAKAVA
NAAAMLVLKAKNVAQVAEDTILQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQL
IEAGKLVDRSVENCVRACQAATGDAELLKQVSAAASVVSQALRDLLQHVRQFASRGEPIG
RYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDAEAEIDMENSKKL
LAAAKLLADSTARMVEAAKGAAANPDSEDQQHRLREAAEGLRVATNAAAQNAIKKKIVNR
LEVAAKQAAAAATQTIAASQNAAISNKNPAAQQQLVQSCKAVADHIPQLVQGVRGSQAQA
EDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTA
SQKAHEACGPMEIDSALNTVQTLKSELQDAKMAAVESQLKPLPGETLEKCAQDLGSTSKA
VGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGVAASTNDPTAAHAMLDSARD
VMEGSAMLIQEAKQALIAPGDAESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDVALKNIG
ESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFSDD
FDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLAAKSLSVDPGAPNAKNLLAA
AARAVTESINQLITLCTQQAPGQKECDNALRELETVKGMLDNPNEPVSDLSYFDCIESVM
ENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAG
HQGLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAATIVAKHTSALCNACRIASSKTA
NPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATAPLVEAVENLTAFAS
NPEFVSIPAQISSEGSQAQEPILVSAKIMLESSSYLIRTARSLAINPKDPPTWSVLAGHS
HTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLATRDDISVEA
LQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYFEPLILAAVGVASKILDHQQ
QMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAA
SEVGLVGGMVDAIAEAMSKLDAGTPPEPKGTFVDHQTTVVKYSKAIAVTAQEMMTKSVTN
PEELGGLASQMTSDYGHLALQGQMAAATAEPEEIGFQIRTRVQDLGHSCIFLVQKAGALQ
VCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMF
ATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQL
AEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLIGATKGAASKPADDPSMYQLKGAA
KVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYIKQELTVFQSKEVPEKTSSPEESIRM
TKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQASFYPDVSDEVRTRALR
YGTECTLGYLDLLEHVLVILQKPTPELKHQLAAFSKRVAGAVTELIQAAEAMKGTEWVDP
EDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQILEAAKSIAAATSA
LVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGH
ASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQVMVTDAGGKILLLERAAGNAV
KRASDNLVRAAQKAAFGKTDDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARKKLAQ
IRQQQYKFLPTELREDEG
Download sequence
Identical sequences XP_010639527.1.5607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]