SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010641398.1.5607 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010641398.1.5607
Domain Number 1 Region: 2208-2301
Classification Level Classification E-value
Superfamily C-type lectin-like 1.6e-30
Family Link domain 0.00013
Further Details:      
 
Domain Number 2 Region: 509-648
Classification Level Classification E-value
Superfamily FAS1 domain 7.32e-29
Family FAS1 domain 0.002
Further Details:      
 
Domain Number 3 Region: 1472-1520,1598-1712
Classification Level Classification E-value
Superfamily FAS1 domain 4.32e-27
Family FAS1 domain 0.0031
Further Details:      
 
Domain Number 4 Region: 1712-1867
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-25
Family FAS1 domain 0.0049
Further Details:      
 
Domain Number 5 Region: 966-1123
Classification Level Classification E-value
Superfamily FAS1 domain 7.32e-23
Family FAS1 domain 0.0052
Further Details:      
 
Domain Number 6 Region: 2299-2461
Classification Level Classification E-value
Superfamily FAS1 domain 1.44e-18
Family FAS1 domain 0.01
Further Details:      
 
Domain Number 7 Region: 385-499
Classification Level Classification E-value
Superfamily FAS1 domain 3.01e-16
Family FAS1 domain 0.0093
Further Details:      
 
Domain Number 8 Region: 1131-1241
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000196
Family FAS1 domain 0.0058
Further Details:      
 
Domain Number 9 Region: 1544-1581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000383
Family Merozoite surface protein 1 (MSP-1) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010641398.1.5607
Sequence length 2570
Comment PREDICTED: stabilin-1 isoform X2 [Fukomys damarensis]; AA=GCF_000743615.1; RF=representative genome; TAX=885580; STAX=885580; NAME=Fukomys damarensis; AL=Scaffold; RT=Major
Sequence
MAEPQGCLLLFLLASLLAGSGFIWGQKVQSKRCDVKTKFITHVPCTSCAIKRQMCPPGWL
LHRFPDKITQNCRYEVQLGDSLVSMSGCSTECWKDVVQKACCPGYWGSQCYECPGGAKTP
CSGHGTCLDGMAGNGTCVCQENFSGSACQECRDPHRFGADCQSECSCVHGVCSNGPQGNG
SCLCFAGYSGLHCDRELPVCRSLNCPPNSQCSEEAPTCKCLPGYTQQGGTCLARDPCQSS
PCSPMARCSVSPKGQAQCRCPENYHGDGKVCLPRDPCATNFGGCPSNSTVCLYQKPGKAT
CSCQPGLVSINHNASAGCFGYCFPHTCEKSATCQVTPEGRTRCLCKEGEVGDGRACYGHL
LHEVQKASEMGTLFQRLRATFTMLEQGCQEILTTSGPFTVLVPIATSVSSVSGNMNVLLA
QQLCRQHVIAGQHILEDGLFPSAHTWWTLAGQEITVLFNSLRYTYKYSDQPHQTFTVQKA
NNVASNGVFHVVTPLHWQPLPTTPGSPKQTVSQILAANEVFSRFETILENCGLPSILDGP
GPFTVFVPSNKAVDSLRDGRLIYLFTAGLSKLQELVRYHIYNRGQMTVAKLIAKGRILTL
ANQVLAVNVSDEGRILLGPEGVPLRQVDILAANGVIHMLEGVLLPPTILPILPKHCDEEQ
HKIVVGSCVDCQALNTSVCPPNSVKLDILPKECAYTHDSAGLNVLKKGCANYCNQTVTKL
GCCKGFFGPDCTQCPGGFSNPCYGKGNCSDGIQGNGTCLCFPDYKGIACHVCSNPKKHGD
QCQEDCGCIHGLCDNRPGSGGVCQQGTCVPGFSGRFCNETVRDCGPTGPAQLCHQHARCI
SQEGVTRCVCLDGFEGDGFSCARRNPCSQPDRGGCSENAECVAGDLGTHHCTCHKGWSGD
GHVCVAIDECGLDTRGGCHADALCRYVGPGQSQCTCKLGFAGDGYECSPIDPCRAGNGGC
HGLATCKAVGGGQRVCSCPPHFGGDGFNCYGDIFRELEANAHFSTFYQWFKSASITLSAD
NRVTVLVPSESAIRRLSPEDKAFWLQPKMLPVLVRAHLLQGALSEEDLARLGGREVVTLN
PTTRWEIHNISGRVWVQNASVDVADLLATDGVLHIISQVLLPPRGVVQAGQGVLQQLKQV
PAFRLFGELLQRHQLVPQIEAATAYTIFVPTNQSLEVQGNSSLDADTVRHHVILGEALST
EALQRGGHRNSMLGPAHWLVFYNHSGQPEVNHTPLEGPLLKGPGYSLFGLSGVLTVGSSR
CLHSHAEALREKCINCTRKFRCTQGFQLQNTPKKSCVYRSGLSFSRGCSHTCVKKIQVPD
CCPGYFGTLCEPCPGGLGGVCSGHGQCQDRFLGSGECRCQEGFHGTACEMCELGRYGPNC
TGVCDCAHGLCQEGLRGDGSCVCNVGWQGLRCDQKISGPQCAKCDLNANCIQSSAGAPAC
VCAAGYSGNGSYCSEVDPCAHSHGGCSPHANCTKVAPGQRTCTCQDGYTGDGELCQEVKS
CLVHNGGCHIHADCISTGPQQVFCNCREGYSGDGIQTCELLDPCSKNNGGCSPYAVCKST
GDGQRTCTCDTARTVGDGFTCRARVGLELLRDKQASFFSLHLFEYKELKGEGPFTVFVPQ
ADLMTNLSQDELARIGAHRQLVFRYHVVGCRQLWSPELLEQGYATALSGHSLRFSEREGS
IYLNDFARVVSSDHEAVNGVLHFIDRVLLPPDVLHWEPDTIAVPRSNVTTAAESFGYKIF
SRLVKVSGLLPMLRDASHRPLTMLWPTDAALQALPLDRQAWLYHEDHRDKLAAILRGHVI
RNVEALASDLPNLGPLRTMHGTPISFSCGRGRPGELMVGEDDARIVQRYLAFEGGLAYGI
DQLLEPPGLGSRCDRFETRPLRLKTCSICGLEPPCPEGSREQGSIEACWRYYSKLWTSLA
QRTFMHGGVWLRPSFWGQPQGLGRGCQRSCVTTTWKPSCCPGHYGSECQACPGGPSSPCS
DHGVCLDGISGSGQCRCHSGFAGTACELCAPGAFGPQCQACHCTPHGHCDEGLGGSGSCF
CDEGWTGPHCEVQLELQPVCTPPCAPQAMCRAGNSCECSLGYEGDGRVCTVADLCQDGHG
GCSEHANCSQVGTVVTCVCLPNYEGDGWSCRARNPCADSHRGGCSEHADCLYTGPNARRC
ECHAGYVGDGLQCLEEAEPPVDRCLGRPPPCHSDAVCTDLHFQEKRAGVFHLQAPDVPYG
LTFSEAEAACGAQGGVLASLPQLSAAQQLGFHLCLMGWLADGSAAHPVVFPAADCGDGRV
GVVSLGTRKNLSERWDAYCYRAQDVACRCRAGFVGDGISTCNGKLLDVLAATANFSTFYG
MLLGYANATKQGLDFLDFLDDELTYKTLFVPVNEAFVDNTTLSGPDLELHASNTTLLSTN
ASQGTLLPTHSGLSLIISDVGPENSSWAPVPPGTVVVRHVIVWDIIAFNGIIHALASPLL
TPPQAGAVIAPERRPVAASVGAVVATGALLSLVAGALYLQARGKPTGFGFSTFQAEEDAD
DDFAPWQEGNPTLVSVPNPVFGSHDAFCEPFDDSLLEDDFPDTQRILAVK
Download sequence
Identical sequences XP_010641398.1.5607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]