SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010643492.1.5607 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010643492.1.5607
Domain Number 1 Region: 15-238
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.16e-53
Family Ankyrin repeat 0.0000922
Further Details:      
 
Domain Number 2 Region: 252-294
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000301
Family SOCS box-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010643492.1.5607
Sequence length 405
Comment PREDICTED: ankyrin repeat and SOCS box protein 9 [Fukomys damarensis]; AA=GCF_000743615.1; RF=representative genome; TAX=885580; STAX=885580; NAME=Fukomys damarensis; AL=Scaffold; RT=Major
Sequence
MDNRPEGSNTRMPLGLGGFVDNRRFSNSFMKDIVSYWSPVHEAAIHGRLFYLRNLINQGW
PVNISTADQVSPLHEACLGGHPSCANMLLRHGAQVNAVTTDWHTPLFNACISGSLDCVHL
LLQHGASPHSESDLASPIHEAAKRGHVECVEMLIAHGANINHNISLLGTPLYLACEKQQI
ACAKKLLESGASVNQGRDLDTPLHAVARLSNGELACLLMDFGANTQARNADGKRPVELVP
PDSPLINLFLQREGPASLMELCRLRIRQCFGIQQHHKISELTLPETLKQFLLHINCVEGM
DLQTRAKHCVAAEGIHRNEAITVIQTISPHLRKLHCMLKEAQLSLHFIIECEKEDAFGTC
IVPPQPASDLSRRRDGQLLANLDSDCTCKTNLKHTPFCISLRDLF
Download sequence
Identical sequences XP_010643492.1.5607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]