SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010648344.1.54126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010648344.1.54126
Domain Number 1 Region: 38-359
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.04e-104
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000244
Further Details:      
 
Domain Number 2 Region: 358-402,430-559
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-36
Family Glycosyl hydrolases family 32 C-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010648344.1.54126
Sequence length 565
Comment PREDICTED: beta-fructofuranosidase, insoluble isoenzyme CWINV1 isoform X2 [Vitis vinifera]; AA=GCF_000003745.3; RF=representative genome; TAX=29760; STAX=29760; NAME=Vitis vinifera; cultivar=PN40024; AL=Chromosome; RT=Minor
Sequence
MGRFGIWVVGLCLMVGGHGIEGETSHHSYRNLQSDPADQPYRTAYHFQPPKNWMNDPNGP
MYYNGVYHLFYQYNPYAAVWGNITWAHSTSYDLVNWVHLELAIKPTDPFDINGCWSGSAT
ILTGEEPVIIYTGKDSQNRQVQNLSVPKNISDPLLREWIKSPHNPLMTPIDGIDASNFRD
PTTAWQGSDKVWRILVGSLINGHGTALLYRSRDFVNWNKSQTPLHSSNKTGMWECPDFYP
VSISSRNGVETSVQNAETRHVLKASFNGNDYYIMGKYVPETDTYLVETGFLDAGSDLRYD
YGKFYASKTFFDAAKKRRILWAWIQEADKDTEKGWSGLQSFPRSVLLDQNGQRLVQWPVK
EIAILHKNQVTFHNKELRGGSVIEVSGITASQADVEVSFDFPHLEEAELMDPSWTDPQAL
CSRKNVSVKGGIGPFGLLVLASNNLTEQTAIFFRIFKSTQEKHIVLMCSDQSRSSLRQDV
DKTIYGAFVDIDLNHEQISLRSLIDHSIVESFGGKGKTCITARVYPELAINTEAHLYAFN
SGNQTLNISTLSAWSMKNAEMVPTN
Download sequence
Identical sequences XP_010648344.1.54126 29760.GSVIVG00032195001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]