SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010702384.1.42505 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010702384.1.42505
Domain Number 1 Region: 421-472
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000000000000442
Family Transcriptional factor domain 0.0029
Further Details:      
 
Domain Number 2 Region: 162-242
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000000458
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0028
Further Details:      
 
Domain Number 3 Region: 3-46
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000903
Family PWWP domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010702384.1.42505
Sequence length 474
Comment transcription elongation factor-like protein [Leishmania panamensis]; AA=GCF_000755165.1; RF=representative genome; TAX=5679; STAX=5679; NAME=Leishmania panamensis; strain=MHOM/PA/94/PSC-1; AL=Chromosome; RT=Major
Sequence
METYAPGDRVWVYIEGDGWWPARVLSDEEMGTRTPGLDLAVQFYAGVEQPATLYELNSHA
DAANICFFETSSEKAVTGNPELEASIRHASADAEANPLKSASAMVVGTRVAAGGSGAAGN
LGAVAVNRAAAKRVRDTGDGSMGTYDGGAAASRPVSGYHHLRSEELHELSRKISSAVAAQ
DVATVRAVLCRLDSVDVYLTELEDTKIGVAVGSVLSQLELKPLWPLARAMVSFWARHLPP
ETLAAIRSVQQRQLSFPPIGASAAASATQHSSPLGKQQRVSFALPGESAFMNSVSPSVTT
TAAGAGAAVSVDSGVVASPQGKTFYDNVYQLLDSPLSAMRYDDAVIEKVTRKLAAEITDR
DERQLLLLRLREEELSFIRDNLLSGEWTPKKYLDQPNEVFTTKSEKARQEQRIQEKIKAI
EAADNARLNITALFKCGRCGKRHCTFYEQQTRSADEPTTKYITCLDCKHTWIQE
Download sequence
Identical sequences A0A088S004
XP_010702384.1.42505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]