SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010707461.1.16129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010707461.1.16129
Domain Number 1 Region: 209-462
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.29e-54
Family Bacterial dinuclear zinc exopeptidases 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010707461.1.16129
Sequence length 469
Comment PREDICTED: carboxypeptidase Q [Meleagris gallopavo]; AA=GCF_000146605.2; RF=representative genome; TAX=9103; STAX=9103; NAME=Meleagris gallopavo; breed=Aviagen turkey brand Nicholas breeding stock; AL=Chromosome; RT=Major
Sequence
MKYLFLIFFMNLLPQYAGKSLSRDGNYPKTFEDIRNEIAGYYDIAKAIIDLAVYGKAQNR
SYERLAVFADTIGPRLSGSKNLDAAIKYMYSALQKDGLENVHLEPVKVPHWERGEEFAMM
LEPRNHSIAILGLGSSVATPPEGITAEVIVVASFDELHRRAQEAKGKIVVYNQPFITYGE
TVRYRSLGAVEAAKVGAVASLIRSVASFSIDSPHTGWQNYQSGIPQIPTACISVEDAEMM
SRMSFRGTKIVVYLKMGARTYPDSASFNTVAEIVGSKYPEQIVLVSGHLDSWDVGQGAMD
DGGGAFISWEALTLIKDLGLRPKRTLRLVLWTGEEQGGIGAEQYYQLHKENISNFDIVME
SDEGTFKPSGLAFTGNAKAHDIVREIMALLLPINITEVYDAADGTDINFWMRDGVPGASL
RDDLSKYFWFHHSQGDTMTVQDPNQMNLCAAVWTVVSYIIADMEEMLPR
Download sequence
Identical sequences G1NHR0
XP_010707460.1.16129 XP_010707461.1.16129 XP_010707462.1.16129 XP_010707463.1.16129 XP_019469705.1.16129 ENSMGAP00000012733 ENSMGAP00000012733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]