SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010716062.1.16129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010716062.1.16129
Domain Number 1 Region: 135-378
Classification Level Classification E-value
Superfamily VPS9 domain 3.53e-58
Family VPS9 domain 0.00059
Further Details:      
 
Domain Number 2 Region: 671-888
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.64e-49
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 3 Region: 394-427,459-605
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.62e-46
Family Ankyrin repeat 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010716062.1.16129
Sequence length 1087
Comment PREDICTED: ankyrin repeat domain-containing protein 27 isoform X2 [Meleagris gallopavo]; AA=GCF_000146605.2; RF=representative genome; TAX=9103; STAX=9103; NAME=Meleagris gallopavo; breed=Aviagen turkey brand Nicholas breeding stock; AL=Chromosome; RT=Major
Sequence
MAMYDEDLLKNPFYLAIQKRRPDLCSKVAEQHGIVLVPCKGSLSSNCLSNCQFESYVLKP
LEENFQTLNGKEIFIQGNLVILGTGFNYHLSVPVLFEETFYNEKEESFSILCIAHPLEKT
ENSNESTASSNLYSLKNIEDVREFLGRHCERFDKYIGSFYRTFKEHERKSLRHYIDSVSA
LYTKCLQHLLRDSHLKMLAKQEEQMNLIKQAVEMYVHHAIYDLVFKYVGTIEASEDAAFN
KITRSLQDLQQKDIGVKPEFSFNIPRAKRELSQLNKCTSPQQKLLCLRKVVQIIMQCPSQ
RVNMETMCADDLLSVLLYLLVKTEIPNWMANLSYIKNFRLCSSVKDELGYCLTSIEAAIE
YIRQGNLSDRSTESDRLYDKLLLKQRMNFLSQMSTTPIDCLFKHIASGNQEEVERLLSQG
DSDKDTVQKMCHPLCYCDKCEKLVSGKLNDPSIVTAFSRDDRGYTPLHIAAICGQTSLVD
LLVAKGAIVNATDYHGSTPLHLACQKGYQNVTLLLLHYKANTDGQDNNGNTPLHLACTYG
HEDCVKALVYYDVHSCRLDIGNEKGDTPLHIAARWGYQGIIEVLLQNGANPNTQNRMKET
SLQCALNSKILSLMELNYLTFERGQSASESPHRSPQHSTETFSRGSSVSSLSSASIDVRQ
DEVKNSYKEVEKLLRAVADGDLEMVRYLLEWTEEDLEDEDDAVSTLKPEFCHPLCQCSKC
GPAQKKFARVPANGLGVNMSNQDGFTPLHMAALHGHSDLVSLLLKHGASISAKNAEHAAP
LHLACQKGHSQVVECLMNYNAKQNKKDAYGNTPLIYACLNGHYETTALLLQRGASVNLSN
AKGNTALHEAVIGKNEALVDLLLQNGARTHIQNERNCTPADCAEPNSNISKLLETAASYV
PASAEEEKECEQHATIKIRRKVNESCEEADDPIRRQHQLVQSINRFNKVKHLRRTITRDK
SVPNFDYQFLHQVETFHMGDSKMDVALSAVSQLYVVLAIKSFDKTKLKSVDTLDQNKAKI
IDAECSGEFMKHDDMIETPCRSKLMHRRHTVNVPLSAESVSGNSLSSPGSPSISQSRDCC
DDLLSKR
Download sequence
Identical sequences G1N1U0
ENSMGAP00000005522 ENSMGAP00000005522 XP_010716062.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]