SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010716916.1.16129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010716916.1.16129
Domain Number 1 Region: 43-151
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.05e-36
Family Frizzled cysteine-rich domain 0.0000875
Further Details:      
 
Weak hits

Sequence:  XP_010716916.1.16129
Domain Number - Region: 175-302
Classification Level Classification E-value
Superfamily TIMP-like 0.0018
Family Netrin-like domain (NTR/C345C module) 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010716916.1.16129
Sequence length 308
Comment PREDICTED: secreted frizzled-related protein 5-like isoform X1 [Meleagris gallopavo]; AA=GCF_000146605.2; RF=representative genome; TAX=9103; STAX=9103; NAME=Meleagris gallopavo; breed=Aviagen turkey brand Nicholas breeding stock; AL=Chromosome; RT=Major
Sequence
MRAVSTEKASRRRGAPWLPGLLLRLLLWGCPGGRASYLRRSSSCTAIPRSMALCYDIGYS
EMRIPNLLEHETMPEVIQQSSSWLPLLARECHPDARIFLCSLFAPICLDRLIYPCRSLCE
AVKRSCAPVMACYGYPWPEILNCNKFPADHELCIAAVSTDESSSSRRTVPRASCKDCELE
EASTAREILDSLCANDFTVKIRILRKNTTTTVSDFDLDPSRVEVLKHGPLLRTEIPGRLQ
QWLDIDATCAHNIMRGTHAGVFVISGEVQSDKVVVNKAYAWQKKNRNLHQAVRRWKHHRC
PEQAGRKV
Download sequence
Identical sequences G1N8W5
ENSMGAP00000008803 XP_010716916.1.16129 ENSMGAP00000008803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]