SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010719666.1.16129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010719666.1.16129
Domain Number 1 Region: 14-167
Classification Level Classification E-value
Superfamily EF-hand 1.5e-39
Family Calmodulin-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010719666.1.16129
Sequence length 187
Comment PREDICTED: guanylyl cyclase-activating protein 3 [Meleagris gallopavo]; AA=GCF_000146605.2; RF=representative genome; TAX=9103; STAX=9103; NAME=Meleagris gallopavo; breed=Aviagen turkey brand Nicholas breeding stock; AL=Chromosome; RT=Major
Sequence
MGANESLPGDGPIPEMHHYYSKFMRECPSGQLSLHEFKKLLDLQGLDPQGDLYIKRVFDI
FDLNQDGFIDFLEFIAAINLVIRGKIDQKLKWYFKLYDADGNGCIDKKELLSIFAAIQAI
NGQTNMTAEEFTNMIFQKIDVNNDGELTLEEFITGVERDEDLMELITKSFDLSNVIKVIQ
NGRRHSI
Download sequence
Identical sequences G1NNK4
ENSMGAP00000015231 ENSMGAP00000015231 XP_010719666.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]