SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010732494.2.61708 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010732494.2.61708
Domain Number 1 Region: 458-592
Classification Level Classification E-value
Superfamily TIMP-like 3.06e-25
Family Netrin-like domain (NTR/C345C module) 0.022
Further Details:      
 
Domain Number 2 Region: 234-329
Classification Level Classification E-value
Superfamily Immunoglobulin 7.03e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 412-465
Classification Level Classification E-value
Superfamily BPTI-like 1.84e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0036
Further Details:      
 
Domain Number 4 Region: 347-406
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000951
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.025
Further Details:      
 
Domain Number 5 Region: 149-201
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000374
Family Ovomucoid domain III-like 0.027
Further Details:      
 
Domain Number 6 Region: 59-105
Classification Level Classification E-value
Superfamily Elafin-like 0.00000235
Family Elafin-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010732494.2.61708
Sequence length 595
Comment PREDICTED: WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 [Larimichthys crocea]; AA=GCF_000972845.1; RF=representative genome; TAX=215358; STAX=215358; NAME=Larimichthys crocea; AL=Scaffold; RT=Major
Sequence
MMFKFPLQLLGDISIKDKSWHNAPNLSKPLFGWILAYLLMLLVCELPELSLCASVAGSKV
KHEGFCPNKLNSNLWVDAQSTCERECNVDEDCADFEKCCTNVCGLNSCVAARFSDGTPAQ
PDGQGGGKGNDAPTSTATCEGFICSQQGAICDIWDGQPICKCQDRCEKEPNFTCASDGLT
YFNRCYMDAEACIRGVSLTVVACRFYLAGPHTSPLPQDTTANPTPTSSQEDPLPPTLYSN
PHHQSIYVGGTVSFHCDVIGVPRPDVTWEKQSERRERLVMRPDQMYGNVVITNIGQLVIY
NAQVWDTGIYTCIARNSVGVLHADYPLSVIRRADDDFSEDPEMPMGRPFSPADCLAEVDL
RVCSGERHVDWYYDSKLASCMAFSNGGCDDSRNRFETYEECKASCQREGMGICSLPAVQG
PCKAWEPRWAWNSLMKQCQAFAYGGCHGNANSFRTKKECEANCPQPKRKPCKTCRVKGKM
VPSLCRSDFAIVGRLTELVEDLDSGLARFSLEEVLRDEKMGLTFFNTKHLEVTIAKIDWS
CPCPNITMEENPLLVMGVVQDGIAIIQSDSYVRAITERRLKKLREVLGKKTCEAS
Download sequence
Identical sequences XP_010732494.2.61708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]