SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010775552.1.77114 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010775552.1.77114
Domain Number 1 Region: 453-587
Classification Level Classification E-value
Superfamily TIMP-like 1.18e-24
Family Netrin-like domain (NTR/C345C module) 0.022
Further Details:      
 
Domain Number 2 Region: 229-324
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 407-460
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0035
Further Details:      
 
Domain Number 4 Region: 342-401
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000017
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.017
Further Details:      
 
Domain Number 5 Region: 145-196
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000568
Family Ovomucoid domain III-like 0.028
Further Details:      
 
Domain Number 6 Region: 57-103
Classification Level Classification E-value
Superfamily Elafin-like 0.00000131
Family Elafin-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010775552.1.77114
Sequence length 588
Comment PREDICTED: WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 [Notothenia coriiceps]; AA=GCF_000735185.1; RF=representative genome; TAX=8208; STAX=8208; NAME=Notothenia coriiceps; AL=Scaffold; RT=Major
Sequence
MFKIPLQLLEHRCIQDPRLDINGPNTNKIGWIRACLLILLICKLPELSLCTSVAGSKVEH
EGFCPNKLNSNLWVDAQSTCERECNVDEDCADFEKCCTNVCGLNSCVAARFSDGTPAQPD
GEGVTEAPISTATCEGFICSQQGATCGIWLGQPICKCQDRCEKEPNFTCASDGLTYFNRC
YMDAEACIRGVTITVVPCRFYLAGPPTSPLPQDTTANPTPTSSQEDHMFPMLYSNPHHQS
VYVGGTVSFHCDVTGSPKPDVTWEKQSERREQLVMRPDQMYGNVVITNIGQLVIYNAQVW
DTGIYTCIARNSAGVLRADYPLSVIRRGLDDFSEDPEMAMGRPFSPADCLAPVDLRVCSS
ERHVDWFYDGKLSTCVAFSNGGCDDSHNRFQTYEECKASCQREGMGICFLPAVQGPCKSW
EPRWAWSSVLKQCQAFAYGGCHGNANSFNSKKECEANCPQAKKKPCKACRVKGRMVPSLC
RSDFAIVGRLTELVEDLDSGLARFSLEEVLRDEKMGLHFFNTKHLEVTIAKIDWSCPCPN
ITMEENPLLVMGVVQDGIAIIQSDSYVRVITERRLKKLRDVLKKKNCV
Download sequence
Identical sequences XP_010775552.1.77114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]