SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010785376.1.77114 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010785376.1.77114
Domain Number 1 Region: 130-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000149
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 2 Region: 95-139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000379
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 3 Region: 55-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000493
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 14-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000565
Family EGF-type module 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010785376.1.77114
Sequence length 200
Comment PREDICTED: neurogenic locus notch homolog protein 1-like, partial [Notothenia coriiceps]; AA=GCF_000735185.1; RF=representative genome; TAX=8208; STAX=8208; NAME=Notothenia coriiceps; AL=Scaffold; RT=Major
Sequence
CPSDYVGNRCQYPSPCSPSPCRNGGECRAVLHGNGFDFRCVCRLGFTDELCLTPNNHACM
SSPCRNGGTCDLITLTVFRCRCSPGWSGKTCLLSNPCASNPCANGGQCSAFDSTYICTCP
PAFHGQTCKQDVNECAQSPSPCFNGGACVNEVGSYSCRCPLEYRGQHCETPYMPCSPSPC
QNGGTCVQKGDTTYDCSCLP
Download sequence
Identical sequences XP_010785376.1.77114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]