SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010794176.1.77114 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010794176.1.77114
Domain Number 1 Region: 29-513
Classification Level Classification E-value
Superfamily Sema domain 3.27e-100
Family Sema domain 0.001
Further Details:      
 
Domain Number 2 Region: 1383-1507,1673-1858
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-35
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 858-949
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000344
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 4 Region: 1041-1128
Classification Level Classification E-value
Superfamily E set domains 0.00000000000178
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.072
Further Details:      
 
Domain Number 5 Region: 949-1041
Classification Level Classification E-value
Superfamily E set domains 0.00000000000815
Family E-set domains of sugar-utilizing enzymes 0.067
Further Details:      
 
Domain Number 6 Region: 511-557
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000366
Family Plexin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010794176.1.77114
Sequence length 1897
Comment PREDICTED: plexin-D1 [Notothenia coriiceps]; AA=GCF_000735185.1; RF=representative genome; TAX=8208; STAX=8208; NAME=Notothenia coriiceps; AL=Scaffold; RT=Major
Sequence
MPPSIEIAVLLLGVLALETHRSASALHIQQAFASPNQTNNFAVDPVSRKVYLATVNTVYQ
LNGTLSIEVEQRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNHNKLLKLDRDQGVVLVCGS
VYQGFCELRNIENISEIAVEFPHQGEKTVFPSMLNIAANHPNASTVGLIFKSHGGNTRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNIKDLSRLFTYDINPSEDNVFKIKQ
DVKTKNKLNFVHAFMQKTYSYIAFNNDAKMGNKESLPNSILARICLDTENLRKPSGSESR
KLTESYIQMPLQCGFNGNIYNRLLSVYPAEIPTEDGKSSEPYLFGVFSKADRKSALCAFK
FGDIDEEIRQGRRNCSNSPSSDVQVLDSVIQGSGAACIQKGNLVLQPDQLDCGAAHLQHP
LALRRSLRAIPLVEYTGLTSVSVDNVHNHTVVFMGTSNGRLRKLTLLANMTLRNQWTLKL
PASEAVHHIMTFDPNDRNFLYLMTSHHMLRVRVADCDQWTSCGECLGAGDAHCGWCTLEN
RCTIQKECAQGLLARSWISMGEGPQQCPSMTLTPPEISIAADIKDVGILINGSVPDLVNS
RVECEYGPGVSTAATVHLDYGPAQIQTCPLLPRENYQPIRPGTDHLTVSVAIKVNGTSVV
SGSFIIYDCKRTGAIHPKTSCLSCLSTRWKCYWDHENHLCVSNKDESKHSLLENAASCPS
LVASEVPPSPSEMAQDFTLSLSHIQENEELECDFGTEQRYEATWLNSSTVKCSGVTLSTN
HRSQVYHLNLRRKGYLSGNGDDVFVDSPQPMRVEVYNCGVGSSDCSQCWGREDQGHLCGW
CENSCRPRDDCQPIRDQCPAPEIHKISPLRGPVEGGTLLTVQGRNLGRRAAAVKVSIGDV
PCILLPELYTVSVEMVCVTGQSSHERTNIVEVDVDQSGIGTSKESFFYLIPKLHSLEPTK
GSRAGGTIVIISGENLDIGSQVRVKVNNTLECTITDKTDETIECTMPPALQAHTESVAVC
VEFENLPCQSAELSTSYTYQKNPTISFIHPKKSYLSGGRTITVTGQGFDLVQSVNMEVME
IGEKRCSVVSPFTITCPSPASSQSQQTTTQFILNGVLYTGDNPFTFDSDEEDGEPHKGHF
PLEYVEDPQFFTASKEKLIKHHPGEPLTLIINKGPSDLELMPEEYSVMIGSYPCNISFHN
DQLFHCTINGLLSSNENELPVTVQVGNFRHTIAIVQLGGSELAIVVSIVVCCVLLLLCTV
ALVVYCTKSRRAERYWQKTLLQMEEMESQIRDEIRKGFAELQTDMTDLTKELNRSQGIPF
LEYKQFVTRTFFPKMFSDYEKSLVQPAFEYDGLGPRVLPETHPLLQDWQEDNTTKPNVEE
GITLFSTLLNNKHFLVTFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDLLV
DLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINKG
SIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSISIKVMNTDTISQVKEKIL
EAFYKNLPFSQWPRAEDVDLEWFDSGSNSKVLQDLDNSTLMEDGRKKLNTVFHYQIPEGA
SLAMSMKDKRDNTLGRVKDLDTEKYVHLVLPHDDQNDHKRSHRTSHRKKVLPEIYLTRLL
STKGTLQKFLDDLFQAILSIPQDRPPLAIKYFFDFLEEQADKRGITDPDTLHIWKTNSLP
LRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEI
PEYKKRVQCYYKQIQDMPPLSEQEMNAHLAEESRKYRNEFNTTLALTEIYKYAKKYRTQV
VTALESNPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_010794176.1.77114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]