SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010796131.1.77114 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010796131.1.77114
Domain Number 1 Region: 44-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000172
Family Laminin-type module 0.00026
Further Details:      
 
Domain Number 2 Region: 100-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000279
Family Laminin-type module 0.0013
Further Details:      
 
Domain Number 3 Region: 151-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 4 Region: 3-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000167
Family Laminin-type module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010796131.1.77114
Sequence length 197
Comment PREDICTED: laminin subunit gamma-1-like, partial [Notothenia coriiceps]; AA=GCF_000735185.1; RF=representative genome; TAX=8208; STAX=8208; NAME=Notothenia coriiceps; AL=Scaffold; RT=Major
Sequence
HTHTEVVCTNCPAGTTGKRCELCDDGFFGDPLGQSGPVRACRACKCSENIDPNAVGNCER
ETGECLKCIYNTDGFFCDRCRDGFYGNALATAVGDKCKACSCSPLGTLGSQVSCSQVTGQ
CLCLSNVEERDCSACQPGFYNLQSGDGCDRCNCNPIGSTNGQCDITSGQCECQPGVTGGH
CERCEENSFGFSASGCK
Download sequence
Identical sequences XP_010796131.1.77114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]