SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010800859.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010800859.1.76553
Domain Number 1 Region: 251-520
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-79
Family Protein kinases, catalytic subunit 0.00000000124
Further Details:      
 
Domain Number 2 Region: 107-281
Classification Level Classification E-value
Superfamily SH2 domain 2.38e-38
Family SH2 domain 0.00000845
Further Details:      
 
Domain Number 3 Region: 73-116
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000137
Family SH3-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010800859.1.76553
Sequence length 527
Comment PREDICTED: tyrosine-protein kinase Fgr isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MGCVFCKKLEPGAKEDGGLEGDFRNYGAADRYGPDPTQSRPASSFSHIPNYNSFSPQPAS
PAFLDAGTIRGISGIGVTMFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSLSS
GHTGYIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNSRGAFLIRESETTKGAYSL
SIRDWDQTRGDHVKHYKIRKLDTGGYYITTRAQFDTVQELVQHYLEVNDGLCHLLTAACT
TMKPQTLGLAKDAWEISRSSITLEHRLGTGCFGDVWLGTWNGSTKVAVKTLKPGTMSPKA
FLAEAQIMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLEFLKGPEGHVLKLPHLVDM
AAQVAEGMAYMERMNYIHRDLRAANILVGERLVCKIADFGLARLIEDDEYNPQQGTKFPI
KWTAPEAALFCRFTIKSDVWSFGILITELITKGRVPYPGMNNREVLEQVEHGYHMPCPPG
CPASLYEVMEQTWRLDPEERPTFEYLQSFLEDYFTSTEPQYQPGDDT
Download sequence
Identical sequences A5PKG9 L8IJK5
NP_001092461.1.59421 NP_001092461.1.76553 XP_005203207.1.76553 XP_005203208.1.76553 XP_005203209.1.76553 XP_005203210.1.76553 XP_005203212.1.76553 XP_005895967.1.15283 XP_010800859.1.76553 XP_010800861.1.76553 XP_010828435.1.44457 XP_010828436.1.44457 XP_010828437.1.44457 XP_010828438.1.44457 XP_010828439.1.44457 XP_010828440.1.44457 XP_010828441.1.44457 XP_010828442.1.44457 XP_010828444.1.44457 XP_010828445.1.44457 XP_015315783.1.76553 XP_015315795.1.76553 XP_019835835.1.53367 XP_019835844.1.53367 XP_019835850.1.53367 XP_019835856.1.53367 XP_019835863.1.53367 XP_019835870.1.53367 XP_019835878.1.53367 ENSBTAP00000015646 9913.ENSBTAP00000015646 ENSBTAP00000015646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]