SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010801327.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010801327.1.76553
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000633
Family Calbindin D9K 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010801327.1.76553
Sequence length 872
Comment PREDICTED: trichohyalin-like protein 1 isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MPQLLRDILCVIETFHKYAREDAATLTCTELKQLIQSEFEDIFQPCAIHAVERNLNLLNI
DSNGAISFDEFVLAIFSFLNVCYLDTQSLLNSEPRQVSKPEGMPHDMGLQVTNETDQWTE
GTSQTQDKVVLPSGTASSTHLSLEERAVEHNRVDPQGHTTAHKLPVETSEHSDSKNQHLK
GDEQSQKVDQDVSATGDSRTQRETSKPMAGSEQISSHTKGEGQNKEILQKGDILARKQSG
TETGGRFGEQEGSLGILHSPLEETTQRPGGSSEDQEVAGEKGVKGHPKSQEPSVQGKDEP
SSEHVDLPKQAAARKPSQTQKSAAAKDESRTAETPEPPIQEKEYETRDLSVQGENRNVSE
TPMVRVERKGVRGPEVHQTVGQKQIEEKTQPPALEEPTEDKKYHELQESSKEKNAGEDSE
THELNSEGGEQKDSESEGAISPGEEARHAEEGTAEALVNSKNAPEAEGTPGTRERIWELT
TLENQSGEKNKMTTKIHDKLVKEDDGYQGEGSEPVATQNDERSPETPNSLTAEDGDSNSE
TSDLFVQGDSQSQTNPFRGSVQGSDSNNPETQKHLALSEEKRVQEAAVLAVRGEDEQVTE
EHAQEHEGQGSATTGRGPAVEPRGHSDTQVFIVRDENTKSLEPGIPGAPNAGITKQLSVR
QLPTKKDSRKELKDQSPSTKKEEDGALEAQEDLVKSLDENNAVSQKTCPATLEEETESPQ
QLAGEQSLSTKEHDPSVSESGLEERMQRDQELCLVERGAEHSSPLYEALQEKMLQQTNVT
QGKHQNQAQTASVASPEIRRNQSSASLTNDSSDGLVFFIDRQALQKYIREFLPDEDPTGA
QQISAPQALEDKQGRPQREELEPQKEASTPKQ
Download sequence
Identical sequences F1MAV8
ENSBTAP00000021074 XP_010801327.1.76553 ENSBTAP00000021074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]