SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010815987.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010815987.1.76553
Domain Number 1 Region: 2218-2312
Classification Level Classification E-value
Superfamily C-type lectin-like 5.18e-31
Family Link domain 0.00016
Further Details:      
 
Domain Number 2 Region: 518-656
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-29
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1482-1530,1608-1722
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-26
Family FAS1 domain 0.0026
Further Details:      
 
Domain Number 4 Region: 1723-1877
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-24
Family FAS1 domain 0.0052
Further Details:      
 
Domain Number 5 Region: 974-1131
Classification Level Classification E-value
Superfamily FAS1 domain 3.01e-23
Family FAS1 domain 0.0032
Further Details:      
 
Domain Number 6 Region: 397-510
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-19
Family FAS1 domain 0.0079
Further Details:      
 
Domain Number 7 Region: 2309-2472
Classification Level Classification E-value
Superfamily FAS1 domain 6.41e-17
Family FAS1 domain 0.008
Further Details:      
 
Domain Number 8 Region: 1140-1263
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000693
Family FAS1 domain 0.0063
Further Details:      
 
Domain Number 9 Region: 1554-1591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000574
Family Merozoite surface protein 1 (MSP-1) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010815987.1.76553
Sequence length 2581
Comment PREDICTED: stabilin-1 isoform X1 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MAGPRGHLLLCFLALCLAGPSFFGEQKGPGPSLQTLPLGQVRSKRCDVKTKFVTHIPCTP
CPAIKKRVCPLGWIRAFPEKISQDCRYEVQLGDSLLSMSGCSLECWKDMVQKACCPGYWG
SQCYECPGGAETPCSGHGTCLDGLDGNGTCVCQENFSGSACQECRDPNRFGPDCQSVCRC
VHGVCRHGPRGDGSCLCFAGYTGARCDQELLACQALNCPRNSQCSEEAPSCSCLPGYTQQ
GHECRASDPCRPSPCSPLAQCSVGPGGQAQCRCPENYHGDGTVCLPQDPCTTNNGGCPSN
STLCLYRKPGQASCLCKPGLVSIAHDSSAGCFAHCSAFSCDRSATCQVTPDGKTSCVCKE
GEVGDGRACYGHLLHEVQKASQTSMLLRLRVTFAMLDQGCREILSTSGPFTVLAPLVSSR
TMNASVAQQLCRQHIIAGQHMLEEAGTQAPRRWWTLAGQEITVSFSRFRKYTYKYQDQPQ
QTFTIHKANYPAANGLFHVVTALRLQPPPELPEDPKRTIGQILASNEVFSRFETILENCG
LPSFLDGPGPFTVFAPSNEAVDGLRDGRLVYLFTAGLSKLQELVRYHVYNHGQLTVEKLL
SKGRVLTMANQILAVNISEEGRILLGPEGVPLRRVDVLAANGVIHMLEGVLLPPTILPIL
PKLCNEEQHAVVAGSCVDCQALNTSTCPPNSVKLDISPEECVYIHDPTGLNVLKKGCAYY
CNQTIQKPGCCKGFFGPDCLQCPGGFSNPCYGKGNCSDGVQGSGACLCFPDYKGIACHIC
SNPNKHGDQCQEDCGCVHGLCDNRPGSGGVCQHGTCAPGFSGRFCNESTVSCGSTEQAQQ
CHPHARCVNQGGVSRCLCLDGFEGDGFSCTPSDPCSRPDRGGCSENAECVPGVRGAHHCM
CHKGWSGDGRVCVAVDECELDLRGGCHADALCSYVGPGQSRCTCKLGFAGDGYVCSPIDP
CRAGNGGCHDLATCRAVGGGQRVCTCPPDYGGDGFSCYGDILKELEANAHFSVFYQWIKG
AGITLPADSQVTALVPSESAIRRLSTEDQAFWLQPRLLPQLVRAHFLQGALSEEELARLH
GQNVSTLNPTVRWEIHNVSGRVWVQNASVDVADLLATNGVLHVLSQVLLPPRRDVLGGQG
LLQQLDSVPAFHLFRELLQRHRLVPQIEAATAYTIFVPTNHSLEAQANSSSLDSDVVRHH
VILGEALSTEALGKGGHRNSLLGPAHWLVFYNHSGQPEVNHVPLEGPVLQAPGRSLFGLS
GVLTVGSSRCLHSHAEALREKCVNCSRKFRCTQGYQLEDTPRKSCVYRSGYSFSRGCSYT
CAKKIQVPDCCPGFFGTLCEPCPGGLGGVCSGHGQCQDRLLGSGECRCHEGFHGTACEMC
ELGRYGPNCTGVCDCAHGLCQEGLRGDGSCVCNVGWQGLRCDQKISGPQCLQKCDPNANC
VQDSAAAPVCVCAAGYSGDGVSCSAVDPCARDHGGCSPHANCTTVAPGQRTCTCLDGYTG
DGELCREANSCLIRHGGCHMHAECIPTGPQQVSCSCREGYSGDGIRACVLLDPCSQNNGG
CSPYAVCKSTGDGQRTCACDAVRTVGDGFTCRARISLELLRDKHASFFSLHLLEYKDLKG
DGPFTVFVPHADLLTNMSQDELARIRANRQLVFRYHVVGCRQLRSQELLEEGYATALSGH
PLRFSEREGNIYINDFARVVSSDQEAVNGVLHFIDRVLLPPEVLHWEADAAPAPRRNFTA
AAETFGYKIFSGLVTMAGLLPLLQDSSHRPLTMLWPTDSALQALPPDRQVWLYHKDHRDK
LAAILRGHVIRNVEALASDLPNLGPLRTMHGTPISFSCSHARPGALTVGEDAARIVQRHL
PFEGGLAYGIDQLLEPPGLGARCDRFETRPLWLKVCSICGLEPPCPPGSQEQGSPEACWR
YFSKFWTSPPLHSLALRSVWTRPSHWGHPQGLGRGCYRNCVTTTWKPSCCPGHYGSECRA
CPGGASSPCNQRGSCMDGMSGSGECRCHTRFAGTACELCAPGAFGPLCQACNCTSHGRCD
EGLGGSGSCFCDEGWTGPRCEVQLELQPVCAPPCAPQAVCRAGNSCECSLGYEGDGRTCT
VVNLCQDGRGGCSEHANCSQAGTAVTCICWPDYEGDGWSCRARNPCEDGLRGGCSEHADC
LNTGPNTRRCVCHAGYVGDGLQCLLEPEPPVDRCLDRPPPCHADAVCTDLHFQEKRAGVF
HLQAPSGPYGLNFSEAEAACGAQGAVLASLLQLSAAQQLGLHLCLVGWLANGSAAHPVVF
PAADCGDGQVGVVSLGARENLSERWDAYCFRMRDVACRCRDGFVGDGTSVCNGKLLDVLA
TTANFSIFYGMLLGYANATPRGLEFLDFLDDERTYKTLFVPVDEAFTDNTTLSGPDLELH
ASNTTFLSANASQGALLPAHSGLSLVIGNLGPGNSSRAPEVPGAVVVSRVIVWDILAFNG
IIHTLASPLLAPPQAWAVVAPEAPPVAAGVGAVVAAGAVLGLVAGALYFRGRSRSAGFGF
SAFQAEDAAADDFSPWQEGTSPPLVSVPNPVFGSHEAFCEPFDDSVLEEDFPDTQRILEV
K
Download sequence
Identical sequences XP_010815987.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]