SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010840071.1.44457 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010840071.1.44457
Domain Number 1 Region: 44-205
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0072
Further Details:      
 
Domain Number 2 Region: 186-302
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.52e-16
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010840071.1.44457
Sequence length 403
Comment PREDICTED: TBC1 domain family member 20 [Bison bison bison]; AA=GCF_000754665.1; RF=representative genome; TAX=43346; STAX=9901; NAME=Bison bison bison; AL=Scaffold; RT=Major
Sequence
MALRSARGDGPTSGRWDGGAEKGDFNAKRKKKVAEIYQALNSEPTDVAALRRMAISEGGL
LTDEIRRKVWPKLLNVNTNDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQRE
GLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVLGERLATSLVEKLSTHHLRDFMDP
TMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYD
FFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFV
QFPPSELAREAAAQPQAEKTAASTFKDFELASAQQRPDMVLRQRFRGLLRPDERTKDVLT
KPRTNRFVKLAVMGLTVALGAAALAVVKSALEWAPKFQLQLFP
Download sequence
Identical sequences Q2T9Q1
NP_001033118.1.59421 NP_001033118.1.76553 XP_010840071.1.44457 ENSBTAP00000017725 9913.ENSBTAP00000017725 ENSBTAP00000017725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]