SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010845906.1.44457 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010845906.1.44457
Domain Number 1 Region: 527-746
Classification Level Classification E-value
Superfamily Bet v1-like 5.91e-40
Family STAR domain 0.0054
Further Details:      
 
Domain Number 2 Region: 96-246
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010845906.1.44457
Sequence length 755
Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X4 [Bison bison bison]; AA=GCF_000754665.1; RF=representative genome; TAX=43346; STAX=9901; NAME=Bison bison bison; AL=Scaffold; RT=Major
Sequence
MQHSGVPIPPSPFSAPPTFLPGVTREGRRGPNSGGGAGRSAGVTTTATADGWKGRLPSPL
DLLPRSAWCQARRRRRRRRGGRTPSLLPLPPAPERALLPSPSPDPSPRGLGASTGAAQGA
GAGLLLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKN
NTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWI
DAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRD
ILCRQVDTLQKFFDACADAVSKDEFQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKVFP
HVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRMDKETEKRRRVEE
AYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHW
STSMPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSL
QDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRN
DWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKIPALNENDPETWIVC
NFSVDHSSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWA
PASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences XP_010845906.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]