SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010847492.1.44457 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010847492.1.44457
Domain Number 1 Region: 56-459
Classification Level Classification E-value
Superfamily Ras GEF 3.92e-91
Family Ras GEF 0.00095
Further Details:      
 
Domain Number 2 Region: 527-591
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.08e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.002
Further Details:      
 
Weak hits

Sequence:  XP_010847492.1.44457
Domain Number - Region: 466-526
Classification Level Classification E-value
Superfamily EF-hand 0.000208
Family Calmodulin-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010847492.1.44457
Sequence length 673
Comment PREDICTED: RAS guanyl-releasing protein 4 isoform X2 [Bison bison bison]; AA=GCF_000754665.1; RF=representative genome; TAX=43346; STAX=9901; NAME=Bison bison bison; AL=Scaffold; RT=Major
Sequence
MNRKDSKRKSHQECPVKTGGRGRPRQARRHKTCPSPREISKVMASMALGMLNEGGCSEDE
LLEKCIQSFDSAGSLRRGDHVLNMVLAMHSWVLPSAHFAARLLTLYQEATGSTQELRRLQ
ICHLVRYWLTQHPETMHQDPQLEEVIGRFWATVEQEGNSVQQSLGDFSSRLSPGGPGPPH
PMSSPGLGKKRKVSLLFDHLETGELAEHLTYLEFRSFQAITPQDLRDYVLQGSVRGCPTL
EGSVGLSNSVSRWVQVMVLSRPGPAQRAQVLDKFIQVAQKLLQLHNFNTLMAVTGGLCHS
AISRLKDSHAHLSPDSTKALLELTELLAAHNNYARYRRTWAGCMDFRLPVLGVHLKDLVA
LNEAQPDRLPDGRLHLPKLNSLYLRLQELAALQQQHPPGNASEDLLHLLTLSLDLFYTED
EIYELSYAREPRCPKSLPPSPFKAPLVVEWAPGVTPKPDTVTLGRHVEQLVESVFKNYDP
DGRGTISQEDFERLSGNFPFACHGLHPPPCQGSGSFSREELTGYLLRASAICSKLGLAFL
HTFQEVTFRKPTFCNSCSGFLWGVTKQGYRCRDCGLCCHRHCRDQVKVECKKRPGAKGDA
SPPEAPVPPTPVPQASCGSEDNLSYTLSLEPETGCHVRHAWTQTESPHPSWEPETVPLPA
KASPPTESSKLNS
Download sequence
Identical sequences Q1LZ97
ENSBTAP00000042303 9913.ENSBTAP00000042303 ENSBTAP00000042303 NP_001030456.2.59421 NP_001030456.2.76553 XP_010847492.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]