SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010850240.1.44457 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010850240.1.44457
Domain Number 1 Region: 2175-2269
Classification Level Classification E-value
Superfamily C-type lectin-like 5.65e-31
Family Link domain 0.00016
Further Details:      
 
Domain Number 2 Region: 505-643
Classification Level Classification E-value
Superfamily FAS1 domain 3.66e-28
Family FAS1 domain 0.002
Further Details:      
 
Domain Number 3 Region: 1447-1495,1573-1687
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-26
Family FAS1 domain 0.0026
Further Details:      
 
Domain Number 4 Region: 1688-1842
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-24
Family FAS1 domain 0.0052
Further Details:      
 
Domain Number 5 Region: 958-1115
Classification Level Classification E-value
Superfamily FAS1 domain 3.01e-23
Family FAS1 domain 0.0032
Further Details:      
 
Domain Number 6 Region: 384-497
Classification Level Classification E-value
Superfamily FAS1 domain 1.19e-18
Family FAS1 domain 0.0079
Further Details:      
 
Domain Number 7 Region: 2266-2429
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000000000103
Family FAS1 domain 0.0093
Further Details:      
 
Domain Number 8 Region: 1124-1247
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000051
Family FAS1 domain 0.0061
Further Details:      
 
Domain Number 9 Region: 1519-1556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000574
Family Merozoite surface protein 1 (MSP-1) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010850240.1.44457
Sequence length 2538
Comment PREDICTED: stabilin-1 [Bison bison bison]; AA=GCF_000754665.1; RF=representative genome; TAX=43346; STAX=9901; NAME=Bison bison bison; AL=Scaffold; RT=Major
Sequence
MAGPRGHLLLCFLALCLAGPSFFGEQKVRSKRCDVKTKFVTHIPCTPCPAIKKRVCPLGW
IRAFPEKISQDCRYEVQLGDSVLSMSGCSLECWKDMVQKACCPGYWGSQCYECPGGAETP
CSGHGTCLDGLDGNGTCVCQENFSGSACQECRDPNRFGPDCQSVCRCVHGVCRHGPRGDG
SCLCFAGYTGAHCDQELLACQALNCPRNSQCSEEAPSCSCLPGYTQQGHECWASDPCRPS
PCSPLAQCSVGPGGQAQCRCPENYHGDGTVCLPQDPCTTNNGGCPSNSTLCLYRKPGQAS
CLCKPGLVSIAHDSSAGCFAHCSAFSCDRSATCQVTPDGKTSCVCKEGEVGDGRACYGHL
LHEVQKASQTSMLLRLRVTFAMLDQGCREILSTSGPFTVLAPLVSSRTMNASVAQQLCRQ
HIIAGQHMLEEAGTQAPRRGWTLAGQEITVSFSRFRKYTYKYQDQPQQTFTIHKANYPAA
NGLFHVVTALRLQPPPELPEDPKRTIGQILASNEVFSRFETILENCGLPSFLDGPGPFTV
FAPSNEAVDGLRDGRLVYLFTAGLSKLQERVRYHVYNHGQLTVEKLLSKGRVLTMANQIL
AVNISEEGRILLGPEGVPLRRVDVLAANGVIHMLEGVLLPPTILPILPKLCNEEQHAVVA
VSAACVGAIFRGEEAPLSSPLESGWLWGSDPAGPGGQRGSQQTLRCVLLQKPGCCKGFFG
PDCLQCPGGFSNPCYGKGNCSDGVQGSGACLCFPDYKGIACHICSNPNKHGDQCQEDCGC
VHGLCDNRPGSGGVCQHGTCAPGFSGRFCNESTVSCGSMEQAQQCHPHARCVNQGGVSRC
LCLDGFEGDGFSCTPSDPCSRPDRGGCSENAECVPGARGAHHCMCHKGWSGDGRVCVAVD
ECELDLRGGCHADALCSYVGPGQSRCTCKLGFAGDGYVCSPIDPCRAGNGGCHDLATCRA
VGGGQRVCTCPPDYGGDGFSCYGDILKELEANAHFSVFYQWIKGAGITLPADSQVTALVP
SESAIRRLSTEDQAFWLQPRLLPQLVRAHFLQGALSEEELARLHGQNVSTLNPTVRWEIH
NVSGRVWVQNASVDVADLLATNGVLHVLSQVLLPPRRDVLGGQGLLQQLDSVPAFHLFRE
LLQRHRLVPQIEAATAYTIFVPTNRSLEAQANSSSLDSDVVRHHVILGEALSTEALGKGG
HRNSLLGPAHWLVFYNHSGQPEVNHVPLEGPVLQAPGRSLFGLSGVLKVGSSRCLHSHAE
ALREKCVNCSRKFRCTQGYQLEDTPRKSCVYRSGYSFSRGCSYTCAKKIQVCPEIGPPPH
PPAGPRGSGECRCHEGFHGTACEMCELGRYGPNCTGVCDCAHGLCQEGLRGDGSCVCNVG
WQGLRCDQKISGPQCLQKCDPNANCVQDSAAAPVCVCAAGYSGDGVSCSAVDPCARDHGG
CSPHANCTTVAPGQRTCTCLDGYTGDGELCREANSCLIRHGGCHMHAECIPTGPQQVSCS
CREGYSGDGIRACVLLDPCSQNNGGCSPYAVCKSTGDGQRTCACDAVRTVGDGFTCRARI
SLELLRDKHASFFSLHLLEYKDLKGDGPFTVFVPHADLLTNMSQDELARIRANRQLVFRY
HVVGCRQLRSQELLEEGYATALSGHPLRFSEREGNIYINDFARVVSSDQEAVNGVLHFID
RVLLPPEVLHWEADAAPAPRRNFTAAAETFGYKIFSGLVTMAGLLPLLQDSSHRPLTMLW
PTDSALQALPPDRQVWLYHKDHRDKLAAILRGHVIRNVEALASDLPNLGPLRTMHGTPIS
FSCSHARPGALTVGEDAARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDRFETRPLWLKV
CSICGLEPPCPPGSQEQGSPEACWRYFSKFWTSPPLHSLALRSVWTRPSHWGHPQGLGRG
CYRNCVTTTWKPSCCPGHYGSECRACPGGASSPCNQRGSCMDSMSGSGECRCHTRFAGTA
CELCAPGAFGPLCQACNCTSHGLCDEGLGGSGSCFCDEGWTGPRCEVQLGEWALCLCPPC
THQCVPLPGPTPSSPPPVVNLCQDGRGGCSEHANCSQAGTAVTCICWPDYEGDGWSCRAR
NPCEDGLRGGCSEHADCLNTGPNTRRCVCHAGYVGDGLQCLLEPEPPVDRCLDRPPPCHA
DAVCTDLHFQEKRAGVFHLQAPSGPYGLNFSEAEAACGAQGAVLASLLQLSAAQQLGLHL
CLVGWLANGSAAHPVIFPAADCGDGQVGVVSLGARENLSERWDAYCFRMRDVACRCRDGF
VGDGTSVCNGKLLDVLATTANFSIFYGMLLGYANATPRGLEFLDFLDDERTYKTLFVPVD
EGFTDNTTLSGPDLELHASNTTFLSTNASQGALLPAHSGLSLVIGNLGPGNSSRAPEVPG
AVVVSRVIVWDILAFNGIIHTLASPLLAPPQAVSVVAPEAPPVAVGVGAVVAAGAVLGLV
AGALYFRGRSRSTGFGFSAFQAEDAAADDFSPWQEGTSPTLVSVPNPVFGSHEAFCEPFD
DSVLEEDFPDTQRILEVK
Download sequence
Identical sequences XP_010850240.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]