SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010850574.1.44457 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010850574.1.44457
Domain Number 1 Region: 148-344
Classification Level Classification E-value
Superfamily Nudix 6.09e-39
Family NADH pyrophosphatase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010850574.1.44457
Sequence length 352
Comment PREDICTED: nucleoside diphosphate-linked moiety X motif 13 isoform X1 [Bison bison bison]; AA=GCF_000754665.1; RF=representative genome; TAX=43346; STAX=9901; NAME=Bison bison bison; AL=Scaffold; RT=Major
Sequence
MSLYCGTACRRKIFWCYRLLSTYVTKTRYLCELKEDDDACKKAQQTGAFYLFHNLAPLLQ
KSEHQYLAPQHSLLELERLLSKFGQDSQILEDSVLIGCSEEQEAWFALDLGLNSSSSINA
SLQKAEIETALQGSFIKLTKALFELNVKDASLLSTAQALLRWHDAHQFCSRSGQPTKKNV
SGSKRVCPSNNIIYYPQVAPVVITLVSDGTRCLLVRQSSFPKGMYSALAGFCDIGESLEE
TVRREIAEEVGLEVDRLHYSASQHWPFPNSTLMIACHATVKPGQTELQVNLRELEAAAWF
SRDEVATVLRRNNPSNQQQSGAVPFWLPPKLAIAHQLIKEWVEKPTCSPLPA
Download sequence
Identical sequences L8HNC7 Q1RMI9
NP_001039370.1.59421 NP_001039370.1.76553 XP_005910205.1.15283 XP_010850574.1.44457 XP_019809337.1.53367 ENSBTAP00000000407 9913.ENSBTAP00000000407 ENSBTAP00000000407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]