SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010852936.1.44457 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010852936.1.44457
Domain Number 1 Region: 118-620
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.56e-162
Family Calponin-homology domain, CH-domain 0.00000000338
Further Details:      
 
Domain Number 2 Region: 5-92
Classification Level Classification E-value
Superfamily EF-hand 1.66e-17
Family Calmodulin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010852936.1.44457
Sequence length 627
Comment PREDICTED: plastin-2 [Bison bison bison]; AA=GCF_000754665.1; RF=representative genome; TAX=43346; STAX=9901; NAME=Bison bison bison; AL=Scaffold; RT=Major
Sequence
MARGSVSDEEMLELREAFAKVDTDGNGYISCSELNDLFKAACLPLPGYRVREITENLMTT
GDLDQDGKISFDEFIKVFHGLKSTEVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSE
EEKYAFVNWINKALENDPDCRHVIPMDPNTNDLFSAVGDGIVLCKMINLSVPDTIDERTI
NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADI
ELSRNEALAALLREGESLEDLMKLSPEELLLRWANYHLENAGCNKINNFSSDIKDSKAYY
HLLEQVAPKGDEEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGNP
KLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDL
SDALVIFQLYEKIKVPVDWSRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGG
QDLNEGNRTLTLALVWQLMRRYTLNILEDIGGGQKVNDDTIVSWVNETLKEAEKNSCISS
FKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNEEEKLNNAKYAISMARKIGARVYAL
PEDLVEVNPKMVMTVFACLMGKGMKRV
Download sequence
Identical sequences F1MYX5
ENSBTAP00000009308 9913.ENSBTAP00000009308 ENSBTAP00000009308 XP_005213731.1.76553 XP_010852936.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]