SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010853794.1.44457 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010853794.1.44457
Domain Number 1 Region: 344-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.62e-24
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.28e-21
Family KRAB domain (Kruppel-associated box) 0.00046
Further Details:      
 
Domain Number 3 Region: 263-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 456-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.05e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 403-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.54e-20
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 6 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.19e-19
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 7 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000535
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 498-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000376
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 97-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000239
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 571-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000585
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 11 Region: 307-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000613
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 12 Region: 224-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000013
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010853794.1.44457
Sequence length 635
Comment PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 709-like [Bison bison bison]; AA=GCF_000754665.1; RF=representative genome; TAX=43346; STAX=9901; NAME=Bison bison bison; AL=Scaffold; RT=Major
Sequence
MDSVTFEDVAVDFTLEEWAFLDPSQKKLYRDVMRETLRNLVSIGEKWEDHDIEDQYKNQG
RKLRSHVVERLCENKEGSQCEENFSIIPNLNMNKKTNRMKPRECSVCGKVFTRHSSLKRH
MSYHTERKPPEYQKYGEKPYRCKECGKAFGYLRFLETHEKNHNREKKYKCEECGKAFHSR
ASFQAHERIHTGEKPYECKECGEAFMWSTGFRRHMVTHTGNASYTCKKCGKAFNCSSSLR
THETTHSEKKPYQCKQCGKFLRYYHTFRTHQRTHTGEKPYECKQCGKAFSCPSSFRKHER
IHTGEKPYECKECGRTFRGLSSLRAHMITHTGDGPYKCQECERAFISPSSFRIHQRIHTG
EKPYKCEQCGKAFNYYNSLQSHRRTHTGEKPYECKECGKTLSHQQTLKIHMRLHTGEKPY
ECKQCGKAFRYYPSFHKHKRSHTGGKPFECKQCGKAFSHYNSLQSHGRTHTGEKPYKCKE
CGKALSHHQTLRVHMRLHTGEKPYECSQCSRAFRYYTSFQKHKRIHTEKKFYEXKEYREA
FSQPTSLXKCXRSHTGEKAYQCKQGGKTLRYFQSLQTHERIPIEEKPCKQCGKSCKNYTS
LEMHERIHTEEKPVTVRDMGKPSDVTRGFHLFLMT
Download sequence
Identical sequences XP_010853794.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]