SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010873663.1.71217 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010873663.1.71217
Domain Number 1 Region: 447-651
Classification Level Classification E-value
Superfamily ARM repeat 0.000000115
Family HEAT repeat 0.062
Further Details:      
 
Domain Number 2 Region: 5-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000283
Family APC10-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010873663.1.71217
Sequence length 949
Comment PREDICTED: centrosomal protein of 104 kDa isoform X2 [Esox lucius]; AA=GCF_000721915.3; RF=representative genome; TAX=8010; STAX=8010; NAME=Esox lucius; AL=Chromosome; RT=Major
Sequence
MPRKIGFTLVSSSSHEDNFSAKELMVHAPTVNGWRSARVCPYPQQVTLQLTERSRVRKLQ
LLAHQYLISSKIEFHIGDRLPEDSPGLSGPLRRLGYVSLSDNEKTGFKARELKSVHVDAI
GTYLRLTFHRNHVNRYNLYNQVALVAINVLGDSVDANAIDTIPGREPLIEHYLNSSQHEK
ALDGTYIGKCDSVSPLDDLAFDMYQDPEVAQIIRLLDDKKQEMVRQERFDLAKTLKQAIA
DLQKVGERMGRYDVEKQCAIEKEDYDMAKKKKDQMEEYRMTVYHQLEVHNLLDAGTITRI
MSSSLSPLQSEDFSKVPSPLRHNTMVVTKTRRGRKQEHPTTETLEPISPKPVSPFPCSLH
PTPRAQLAMPRIDVTGLPYDERPLPAHQRKGVTCDPKESSLPSFPMATTQRSTGVTGVPE
PLTERAKREASFPIEVYGDGLVAAAYSKTWSYREDALLAVYKKLTELSGGTSKEELRNMM
RAAVFLVKKALQDKVSSVFQASLKLLRMLLTQLIPGHALGKAELAHCVEQTWPNLLSRTG
DPGTRLRAMATAFIQDMALFKEVQALQVVPGELVKPMKSNIPVRLALSRTELLEKLLGEV
GTENSGFTLDNVMTFCTGALQHSASEVRETAVRIVLTMYRLHKDAVLRYLPVNDVATRKN
VLYKNIFDGFARIDGRPVESQFQMSKKGGVQQQGDKEKEIRSLQEQLAALREISDKNIFK
AEKEKGKAKTQEKDAKRAVKTGVKKAPQNNPADVGDDNCSILNDLNNLCIFCGDKDESFT
EDGLDLHYWKHCPMLHRCDQCRQVVEIASLTEHLLGECENKAGFSQCPHCLEAVPKDALT
RHTQSPACNPPISDNGSNHCPLCHNNLMPGEEAWKAHLMGREGCKHNSRRTVVSQRAQQT
QGMPGSVTKLRHAWSVGGRARAMCKGSRIPALAPRANRTHTNRLNPARR
Download sequence
Identical sequences XP_010873663.1.71217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]