SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010878289.1.71217 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010878289.1.71217
Domain Number 1 Region: 18-172
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 3.4e-59
Family TRADD, N-terminal domain 0.0000977
Further Details:      
 
Domain Number 2 Region: 210-296
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000287
Family DEATH domain, DD 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010878289.1.71217
Sequence length 299
Comment PREDICTED: tumor necrosis factor receptor type 1-associated DEATH domain protein [Esox lucius]; AA=GCF_000721915.3; RF=representative genome; TAX=8010; STAX=8010; NAME=Esox lucius; AL=Chromosome; RT=Major
Sequence
MDVMDEKKMMTRNVEDGPWTGCAVLFLNSCPTVNLLSLYKDQQGKFMVFKVVKLTLTDSS
GGLEGYEILKVHDADPLLGVEVKFVDVAACRRFLESYVSGAVLQSLSQHASRLLPGSQDV
AMEIQLKAGMYTLDFCLDDLDLCLKHIHQSQPGRLRDDEIAELEQQLQSQALGHVPQPPT
LTQEETPLPSNCFLFQKKVFEDRMLAAGDLQRFSNGVGRDWRKVGRALGKNCRALKGPAI
DNLAYEYEREGLYEQAYQLLSRFIQAEGRAARLGRLVRALEDTKLTSLAENILDIQPQE
Download sequence
Identical sequences XP_010878280.1.71217 XP_010878289.1.71217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]