SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010893571.1.71217 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010893571.1.71217
Domain Number 1 Region: 37-519
Classification Level Classification E-value
Superfamily Sema domain 1.7e-100
Family Sema domain 0.00065
Further Details:      
 
Domain Number 2 Region: 1393-1516,1681-1866
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.22e-33
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 859-956
Classification Level Classification E-value
Superfamily E set domains 0.0000000000178
Family Other IPT/TIG domains 0.037
Further Details:      
 
Domain Number 4 Region: 954-1027
Classification Level Classification E-value
Superfamily E set domains 0.000000000165
Family Other IPT/TIG domains 0.039
Further Details:      
 
Domain Number 5 Region: 1047-1129
Classification Level Classification E-value
Superfamily E set domains 0.000000000168
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.074
Further Details:      
 
Domain Number 6 Region: 517-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000108
Family Plexin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010893571.1.71217
Sequence length 1905
Comment PREDICTED: plexin-D1 isoform X1 [Esox lucius]; AA=GCF_000721915.3; RF=representative genome; TAX=8010; STAX=8010; NAME=Esox lucius; AL=Chromosome; RT=Major
Sequence
MPSSEKIAVLILGVLVLKSPWNAQRIPCLASALQIQQAFASPNQTNNFVVDEVSRTIYLA
TVNSVYQLNGTLSVEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNFNKLLELDREQG
VLVVCGSVYQGFCELRKMENISQIAVEFPPQGEKTVFPSMLNIAANDPNASTVGLIFRTH
GGNTRLLVGATYTGAGTPFFPKNHSKEDLRFENTPEIAIRSLNINEISKLFTYDINPSED
NVFKIKQEAKQKNKLNFVHAFIQKTYSYIAINNDAKMGHKDSQPNSILARICLDTENPRK
STSESRKLTESFIQMPLQCGYNGNIYNRLVSVHPAEIHSGNREGLESYLFGVFTKSDRKS
ALCVFRFSDIEEEIRQGRRNCSNSPSSDVQVLDSVIQGSGAACIQKGNLVLQPEQLDCGA
AHLQHPLALRRPLRAKPLFESLGLSSVAVDNVHDHTVVFLGTSTGRLRKLTLRKNMTVAN
QWSLKLPSAESVHHIMTFDPMDRNYLYIMTSHHLLRVKVASCGQYRTCSDCLGAGDAHCG
WCTLESRCSIQRECTQGSLMRSWIGMGDNSQQCPSMTLTPPEISLSADIKNVGILINGSV
PDLAGSSVECDYGLGIATAATVHLDHGPAQIQTCPLLPRERYPDIPPGRDHLTVPVAIKV
NGTSVVSGSFVIYDCERTGVIHPKTACLSCLSTKWRCYWDIHSHSCLSTKDDSRHELLEN
AASCPSLVAVDVEPSPSGMTQDFTLSLRNVEQREELECYFGNEQKYEAPWTEDSSVKCSG
VTLTTTEKTQVFQLSLQRKGQPDQYIDSPEPITVEVYNCGVGSGDCSQCWARQDQGHLCG
WCDNSCRMGTDCQEGSTQCPDPEITKISPLNGPRSGGTLLTVKGKNMGRRADLVDVSIGG
VSCKILPERYIVSMELVCVTGTTSKTTKEVARVDITVNGSMTSASGVSKEFFSYVDPKLL
SVEPRRGSRSGGTRVTFSGEHLNTGSQVRVKVNGTQDCSIVTLRDDTIECTMPAALHAHT
EAVSMCVEFEDIPCQGAELSTTYTYEKNPSISYIKPKKSFLSGGRTITVAGQGFELVQSV
SMKVLNIGQAACKVRSPSLITCSSPASNQSQLATVKFLLNGVLYTGDSPSFYGPGQEEEE
VEELHGGHFLLEYVEDPQFLTANKERLIKHHPGEPLTLIINKGLSDLELAPEEYSVMIGP
YPCDISFHNDQLFHCTINGSLGSSEGELPVVVQVGNFRRVIAKVQLGGSELAIVVSIVVC
CVLLLLCTVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKE
LNRSQGIPFLEYKQFVTRTFFPKMCSDYERSLVQPVYQTDALGPRALPETHPLLQDWQPS
NTGKPNMEEGITLFSTLLSNKHFLVTFVHALEQQKDFAIRDRCSLASLLTIALHGKLEYY
TSIMKDLLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLC
AIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLAIKVMDTDT
ICQVKEKILEAFYKNLPFSQWPRAEDVELEWFVCGSTRILQDLDNTSVMEDGRKKLNTVT
HYQIPEGASFAMSMKDKRDNTLGRAKDLDTEKYVHLVLPHDELFENRKSHRQSHRKKVLP
EIYLTRLLSTKGTLQKFLDDLFQAILSIPAERPPLAIKYFFDFLEEQADKRGITDPDTLH
IWKTNSLPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSVSDLQLGKDSPTN
KLLYAKEIPEYKKRVQCYYKQIQEMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKY
AKKYRNQVVSALESNPTAKRTQLHHKFEQVIALVEDNIYECSSEA
Download sequence
Identical sequences XP_010893571.1.71217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]