SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_010945038.1.22495 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010945038.1.22495
Domain Number 1 Region: 498-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.11e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 334-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000147
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 3 Region: 447-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000285
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 306-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000142
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 5 Region: 57-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000313
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number 6 Region: 372-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000184
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 7 Region: 142-165,194-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000829
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_010945038.1.22495
Sequence length 649
Comment PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 526 [Camelus bactrianus]; AA=GCF_000767855.1; RF=representative genome; TAX=9837; STAX=9837; NAME=Camelus bactrianus; breed=Alxa; AL=Scaffold; RT=Major
Sequence
MAEVVAEVAEVAEMPTQMTPGAMEMSTPMLGEKTEMSTEVTEMTPGEALASSLFFQFMCS
ECGSLYNTLEEVLSHQEQHVPTVTEEEEALTTLDTGLEPELVPGTEDGPFQCGECSQLIL
SPSELLAHQDAHLRESASQIQYQCGDCQELFPSPELWVAHRKAQHLSATAVKPPVPPPLP
PLTPPPPPPAPPEIKMEPYECPECSTLCTTPEEFLEHQGTHFDSLEKEERNGLEEEEEED
EDEEDEDEETEDEEEAAAEVGDDAVGSEKSTASQVQACGDCPQHWTSPAARRRHQRASHG
PASVAHPFHCSQCQRSFSSANRLLAHGRAHVGGTHECTACSKVFKKAASLEQHLRLHRGE
ARYLCVDCGRGFGTELTLVAHRRAHTANPLHRCRCGKTFSNMTKFLYHRRTHAGKSGAPP
TAVVAASPAPAEPTPPPPPPTPPAQLPCPQCSKSFASASRLSRHRRAVHGPPERRHRCGV
CGKGFKKLVHVRNHLRTHTGERPFQCHSCGKTFASLANLSRHQLTHTGVRPYQCLDCGKR
FTQSSNLQQHRRLHLRPVAFARAPRLPITGLYNYAQARTVTLQPPRSPPTAQPPPPEPQQ
TIMCTELGETIAIIETSQPLALVDTLQLCQAALGASEASGLLQLDTAFV
Download sequence
Identical sequences XP_010945038.1.22495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]