SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010948347.1.22495 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010948347.1.22495
Domain Number 1 Region: 43-156
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 251-365
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000327
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 454-491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 164-201
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 210-249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000115
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 415-452
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010948347.1.22495
Sequence length 745
Comment PREDICTED: LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 3 [Camelus bactrianus]; AA=GCF_000767855.1; RF=representative genome; TAX=9837; STAX=9837; NAME=Camelus bactrianus; breed=Alxa; AL=Scaffold; RT=Major
Sequence
MEKRAFAGPEGAPGARAQLAVVCLVNIVLTGRLSSAVPALAACSGKLEQHTERRGVIYSP
AWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAPPRQEAFRLC
GSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLP
GPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPAERRCDGTQDC
GDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLEL
RLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNA
TYQVKGYCLPWEQPCGSSSEGDVADTGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQ
YPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDC
QDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRL
EAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPS
RRRLGRLWRVLGEGLLQPAAGAAPDPPAPLTDTGSPGAAGDGPSSTSSHASEVGPSVRPP
SGLRDPECRPVDKDRKASRAPLVDNIAPVDTPRESCSAQDPHPPAPTASSTLGPHPPEPL
GVCRSPPPPCSPMLEASDDEALLVC
Download sequence
Identical sequences XP_010948347.1.22495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]